File manager

File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1615361526.M790984P25135.au6.voltdns.com,S=32821,W=33323:2,Sa

Back
Return-Path: <ilinq@sheldoncollege.com> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id UEoJL/Z1SGAvYgAATr7HEg (envelope-from <ilinq@sheldoncollege.com>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Wed, 10 Mar 2021 17:32:06 +1000 Return-path: <ilinq@sheldoncollege.com> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Wed, 10 Mar 2021 17:32:06 +1000 Received: from viclamta36p.bpe.bigpond.com ([203.38.21.100]:54277) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.94) (envelope-from <ilinq@sheldoncollege.com>) id 1lJtK7-0006pj-JR for ianhamilton@seafoodwarehouse.com.au; Wed, 10 Mar 2021 17:32:06 +1000 Received: from extmail.bigpond.com ([10.10.26.4]) by viclafep36p-svc.bpe.nexus.telstra.com.au with ESMTP id <20210310073122.KBFE7599.viclafep36p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Wed, 10 Mar 2021 18:31:22 +1100 Received-SPF: pass (extmail.bigpond.com: domain sheldoncollege.com designates 203.100.4.140 as permitted sender) identity=mailfrom; receiver=extmail.bigpond.com; client-ip=203.100.4.140; envelope-from=ilinq@sheldoncollege.com; helo=mail.sheldoncollege.com; X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduledruddujedgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpefkfffuhffvgggtsegrtdhjredttdejnecuhfhrohhmpefuhhgvlhguohhnucevohhllhgvghgvuceoihhlihhnqhesshhhvghlughonhgtohhllhgvghgvrdgtohhmqeenucggtffrrghtthgvrhhnpedtvdejhfejueehueetleffkefhveehteevieffveefgeeuueelffetfefhudefgfenucffohhmrghinhepshhhvghlughonhgtohhllhgvghgvrdgtohhmnecukfhppedvtdefrddutddtrdegrddugedtnecuvehluhhsthgvrhfuihiivgepjeenucfrrghrrghmpehhvghlohepmhgrihhlrdhshhgvlhguohhntgholhhlvghgvgdrtghomhdpihhnvghtpedvtdefrddutddtrdegrddugedtpdhmrghilhhfrhhomhepoehilhhinhhqsehshhgvlhguohhntgholhhlvghgvgdrtghomheqpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mail.sheldoncollege.com (203.100.4.140) by extmail.bigpond.com (5.8.420) id 5FE6CF5C1324AD9B for aussfdservices@bigpond.com; Wed, 10 Mar 2021 18:31:22 +1100 Received: from ilinq.sheldoncollege.com ([10.40.0.71]) by mail.sheldoncollege.com over TLS secured channel with Microsoft SMTPSVC(10.0.14393.0); Wed, 10 Mar 2021 17:30:19 +1000 Received: from iLinq.sheldoncollege.com (localhost [127.0.0.1]) by ilinq.sheldoncollege.com (Postfix) with ESMTP id 3E96A3601CA for <aussfdservices@bigpond.com>; Wed, 10 Mar 2021 17:30:19 +1000 (AEST) Message-ID: <bb58e7c0323acaaea554cdbfc264411b@swift.generated> Date: Wed, 10 Mar 2021 17:30:19 +1000 From: Sheldon College <ilinq@sheldoncollege.com> To: Mr Ian Hamilton <aussfdservices@bigpond.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="_=_swift_1615361419_a3ed6ecb31cb8601bfd237cbdf533265_=_" MessageID: <d14e59846f3b40d950124f16bcfb6a6e@alaressmailer> X-OriginalArrivalTime: 10 Mar 2021 07:30:19.0275 (UTC) FILETIME=[390AADB0:01D7157F] X-Spam-Status: Yes, score=8.3 X-Spam-Score: 83 X-Spam-Bar: ++++++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: [iLINQ] News FRIDAY'S ASSEMBLY [https://iLinq.sheldoncollege.com/news/12630?ref=email] Content analysis details: (8.3 points, 8.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.8 BAYES_50 BODY: Bayes spam probability is 40 to 60% [score: 0.5000] 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: sheldoncollege.com] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=ilinq%40sheldoncollege.com;ip=203.38.21.100;r=au6.voltdns.com] 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 HTML_IMAGE_RATIO_02 BODY: HTML has a low ratio of text to image area 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 3.5 MSGID_HDR_MALF Has invalid message ID header X-Spam-Flag: YES Subject: *SPAM* Sheldon College News Digest --_=_swift_1615361419_a3ed6ecb31cb8601bfd237cbdf533265_=_ Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable =09=09[iLINQ] =09=09News =09=09FRIDAY'S ASSEMBLY [https://iLinq= .sheldoncollege.com/news/12630?ref=3Demail] _ Mar 10 by Mr Rick Samuel= s _ Invitation to=C2=A0Friday's Assembly=C2=A0along with the=C2=A0high= lights and performance item information. =09=09EVENT REMINDER: MADON= NA KING PARENT INFORMATION EVENING [https://iLinq.sheldoncollege.com/news= /12629?ref=3Demail] _ Mar 10 by Mrs Lisa Slender _ RSVP EVENT REM= INDER:=C2=A0Parents are invited to the upcoming =E2=80=9CTen-Agers= =E2=80=9D Parent Information evening as Madonna King, best selling author= of _=E2=80=9CBeing 14=E2=80=9D_ and _=E2=80=9CFathers and Daughters= =E2=80=9D_ now shares with us what your daughter needs to know about her = shift from child to a teenager =E2=80=93 how she feels, what she thinks, = what worries her and what you can do to help. =C2=A0 =09=09MOTH= ERS' NIGHT OUT - UPDATE OF ARRANGEMENTS [https://iLinq.sheldoncollege.com= /news/12628?ref=3Demail] _ Mar 10 by Miss Beth Cooper _ Important= timing update regarding the upcoming Mothers' Night Out on Saturday 20 M= arch. Tickets are on sale now! =09=09ATOM PHOTO COMPETITION [https:/= /iLinq.sheldoncollege.com/news/12623?ref=3Demail] _ Mar 9 by Mrs Shirl= ey Henderson _ The=C2=A0ATOM Photo Comp=C2=A0is an initiative of Austr= alian Teachers of Media (ATOM). It provides Australian and New=C2=A0Zeala= nd student and adult photographers with the opportunity to submit=C2= =A0a folio of three (3) photographs adhering to a theme, and win fantasti= c prizes in the process. If you do not wish to receive these emails = from Sheldon College, please unsubscribe [http://iLinq.sheldoncollege.c= om/settings/messages]. =C2=A9 2021 Sheldon College [https://www.sheldo= ncollege.com] \| Guidelines of Use and Privacy Policy [http://iLinq.sheldo= ncollege.com/policy] \| Support and Feedback [http://iLinq.sheldoncollege.= com/feedback] --_=_swift_1615361419_a3ed6ecb31cb8601bfd237cbdf533265_=_ Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org= /TR/xhtml1/DTD/xhtml1-strict.dtd"><html xmlns=3D"http://www.w3.org/1999/xht= ml"><head><meta http-equiv=3D"Content-Type" content=3D"text/html; charset= =3Dutf-8"><meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-= scale=3D1.0"><title>Sheldon College News Digest</title><style type=3D"text/= css"> /* This file is subject to Twig, beware the / / use classes, don't = use id's / / will be truncated by mail clients, but we use it for styling= */ body { margin: 0; } table { border-spacing: 0; border-width: 0; border-= collapse: collapse; } td { padding: 0; font-family: Arial, sans-serif; font= -size: 13px; } a { text-decoration: none; } a[href] { text-decoration: unde= rline; } img { display: block; } .wrap { width: 100%; } .inner-wrap { backg= round-color: rgb(235, 237, 237); width: 100%; } .header, .footer { width: 1= 00%; } .header { background-color: rgb(235, 237, 237); } .header img { colo= r: rgb(0, 41, 92) } .content { background-color: white; } .content a { colo= r: rgb(0, 41, 92); } .content p { line-height: 20px; font-size: 13px; margi= n: 0; } .content .heading { line-height: 36px; font-weight: bold; font-size= : 18px; color: rgb(255, 255, 255); } .content a.cta { background-color: rgb= (255, 255, 255); padding: 4px 8px 6px; text-decoration: none; color: rgb(0,= 41, 92); } .content .title { line-height: 24px; font-weight: bold; font-si= ze: 16px; text-decoration: none; } .footer p { color: black; font-family: A= rial, sans-serif; font-size: 11px; line-height: 18px; text-align: right; ma= rgin: 0; } .footer a { color: rgb(0, 41, 92); text-decoration: underline; }= tr.underline td, td.underline { border-bottom: solid 1px rgb(255, 255, 255= ); } .work-month, .work-day { text-align: center; border: solid 2px rgb(255= , 255, 255); } .work-month { text-transform: uppercase; font-size: 12px; ba= ckground-color: rgb(255, 255, 255); color: rgb(51, 84, 125); border-bottom:= solid 1px #fff; } .work-day { font-size: 22px; line-height: 35px; color: r= gb(255, 255, 255); background-color: rgb(0, 41, 92); } </style></head><body= style=3D"margin: 0;"><table class=3D"wrap" style=3D"border-spacing: 0; bor= der-width: 0; border-collapse: collapse; width: 100%;"><tr><td style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table class=3D"= inner-wrap" style=3D"border-spacing: 0; border-width: 0; border-collapse: c= ollapse; background-color: rgb(235, 237, 237); width: 100%;"><tr height=3D"= 90"><td class=3D"header" style=3D"padding: 0; font-family: Arial, sans-seri= f; font-size: 13px; width: 100%; background-color: rgb(235, 237, 237);"><ta= ble align=3D"center" width=3D"640" style=3D"border-spacing: 0; border-width= : 0; border-collapse: collapse;"><tr><td colspan=3D"3" valign=3D"top" heigh= t=3D"8" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.= com/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style= =3D"display: block; color: rgb(0, 41, 92);"></td></tr><tr><td colspan=3D"1"= valign=3D"top" height=3D"32" width=3D"4" style=3D"padding: 0; font-family:= Arial, sans-serif; font-size: 13px; line-height: 32px;"><img src=3D"https:= //iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"32" width=3D= "0" border=3D"0" style=3D"display: block; color: rgb(0, 41, 92);"></td><td = colspan=3D"2" valign=3D"middle" style=3D"padding: 0; font-family: Arial, sa= ns-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncollege.com/im= ages/logo.php?logo=3Dskin_logo_square&size=3Dnormal" alt=3D"iLINQ" bord= er=3D"0" height=3D"72" style=3D"display: block; color: rgb(0, 41, 92);"></t= d></tr><tr><td colspan=3D"3" valign=3D"top" height=3D"8" width=3D"4" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block; color: = rgb(0, 41, 92);"></td></tr></table></td></tr><tr><td class=3D"content" styl= e=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; backgroun= d-color: white;"><table align=3D"center" width=3D"640" style=3D"border-spac= ing: 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"1" = valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: A= rial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://i= Linq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" = border=3D"0" style=3D"display: block;"></td><td style=3D"padding: 0; font-f= amily: Arial, sans-serif; font-size: 13px;"><table style=3D"border-spacing:= 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"3" vali= gn=3D"top" height=3D"16" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 16px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"16" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D"heading" style= =3D"line-height: 36px; font-weight: bold; font-size: 18px; color: rgb(255, = 255, 255);"><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td class=3D"heading" valign=3D"middle" height=3D"32" style=3D"padding: 0; f= ont-family: Arial, sans-serif; line-height: 36px; font-weight: bold; font-s= ize: 18px; color: rgb(255, 255, 255);">News</td></tr><tr><td colspan=3D"2" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><tab= le width=3D"624" style=3D"border-spacing: 0; border-width: 0; border-collap= se: collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif;= font-size: 13px;"><table width=3D"624" style=3D"border-spacing: 0; border-= width: 0; border-collapse: collapse;"><tr class=3D""><td colspan=3D"4" vali= gn=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><td width=3D= "72" height=3D"64" valign=3D"top" style=3D"padding: 0; font-family: Arial, = sans-serif; font-size: 13px;"><table style=3D"border-spacing: 0; border-wid= th: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-family= : Arial, sans-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncol= lege.com/storage/image.php?hash=3D089be4ebf4aecf76c824742e6498e52977548d1b&= amp;size=3Dsquare64" width=3D"64" height=3D"64" style=3D"display: block;"><= /td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"16" style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0px;= "><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" he= ight=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></t= able></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td valign=3D"middle" style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px;"><table width=3D"100%" style=3D"border-spacing: 0; border-w= idth: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-fami= ly: Arial, sans-serif; font-size: 13px;"><a href=3D"https://iLinq.sheldonco= llege.com/news/12630?ref=3Demail" class=3D"title" style=3D"color: rgb(0, 41= , 92); line-height: 24px; font-weight: bold; font-size: 16px; text-decorati= on: none;">FRIDAY'S ASSEMBLY</a></td></tr><tr class=3D"underline"><td colsp= an=3D"1" valign=3D"top" height=3D"8" width=3D"0" style=3D"padding: 0; font-= family: Arial, sans-serif; font-size: 13px; border-bottom: solid 1px rgb(25= 5, 255, 255); line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D= "display: block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"= 4" width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-si= ze: 13px; line-height: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/i= mages/emails/spacer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"dis= play: block;"></td></tr><tr><td style=3D"padding: 0; font-family: Arial, sa= ns-serif; font-size: 13px;"><p style=3D"line-height: 20px; font-size: 13px;= margin: 0;"><em> Mar 10 by Mr Rick Samuels </em></p></td></tr><tr><td styl= e=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><p style= =3D"line-height: 20px; font-size: 13px; margin: 0;">Invitation to=C2=A0<str= ong>Friday's Assembly=C2=A0</strong>along with the=C2=A0highlights and perf= ormance item information.</p></td></tr></table></td><td colspan=3D"1" valig= n=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial,= sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.= sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" borde= r=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><td colspan=3D"4= " valign=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family= : Arial, sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https= ://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr class=3D"dark">= <td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" style=3D"padding= : 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 12px;"><= img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" heigh= t=3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr c= lass=3D"dark"><td width=3D"72" height=3D"64" valign=3D"top" style=3D"paddin= g: 0; font-family: Arial, sans-serif; font-size: 13px;"><table style=3D"bor= der-spacing: 0; border-width: 0; border-collapse: collapse;"><tr><td style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><img src= =3D"https://iLinq.sheldoncollege.com/storage/image.php?hash=3D6f697300ef315= a5eed9674e49fcb29fd20c3e724&size=3Dsquare64" width=3D"64" height=3D"64"= style=3D"display: block;"></td><td colspan=3D"1" valign=3D"top" height=3D"= 0" width=3D"16" style=3D"padding: 0; font-family: Arial, sans-serif; font-s= ize: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/= images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"di= splay: block;"></td></tr></table></td><td colspan=3D"1" valign=3D"top" heig= ht=3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege= .com/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style= =3D"display: block;"></td><td valign=3D"middle" style=3D"padding: 0; font-f= amily: Arial, sans-serif; font-size: 13px;"><table width=3D"100%" style=3D"= border-spacing: 0; border-width: 0; border-collapse: collapse;"><tr><td sty= le=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><a href= =3D"https://iLinq.sheldoncollege.com/news/12629?ref=3Demail" class=3D"title= " style=3D"color: rgb(0, 41, 92); line-height: 24px; font-weight: bold; fon= t-size: 16px; text-decoration: none;">EVENT REMINDER: MADONNA KING PARENT I= NFORMATION EVENING</a></td></tr><tr class=3D"underline"><td colspan=3D"1" v= align=3D"top" height=3D"8" width=3D"0" style=3D"padding: 0; font-family: Ar= ial, sans-serif; font-size: 13px; border-bottom: solid 1px rgb(255, 255, 25= 5); line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/= emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: = block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width= =3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px= ; line-height: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/em= ails/spacer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: bl= ock;"></td></tr><tr><td style=3D"padding: 0; font-family: Arial, sans-serif= ; font-size: 13px;"><p style=3D"line-height: 20px; font-size: 13px; margin:= 0;"><em> Mar 10 by Mrs Lisa Slender </em></p></td></tr><tr><td style=3D"pa= dding: 0; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"lin= e-height: 20px; font-size: 13px; margin: 0;"><strong>RSVP EVENT REMINDER:= =C2=A0</strong>Parents are invited to the upcoming =E2=80=9CTen-Agers= =E2=80=9D Parent Information evening as Madonna King, best selling author o= f <em>=E2=80=9CBeing 14=E2=80=9D</em> and <em>=E2=80=9CFathers and Daughter= s=E2=80=9D</em> now shares with us what your daughter needs to know about h= er shift from child to a teenager =E2=80=93 how she feels, what she thinks,= what worries her and what you can do to help.</p><p style=3D"line-height: = 20px; font-size: 13px; margin: 0;">=C2=A0</p></td></tr></table></td><td col= span=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; fon= t-family: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src= =3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0"= width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr class=3D"= dark"><td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" style=3D"p= adding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 12= px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif"= height=3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr= ><tr class=3D""><td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-= height: 12px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/s= pacer.gif" height=3D"12" width=3D"0" border=3D"0" style=3D"display: block;"= ></td></tr><tr class=3D""><td width=3D"72" height=3D"64" valign=3D"top" sty= le=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table = style=3D"border-spacing: 0; border-width: 0; border-collapse: collapse;"><t= r><td style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;= "><img src=3D"https://iLinq.sheldoncollege.com/storage/image.php?hash=3D55f= 084a1a098d48bd6e01e3d538a5cd52b9c0324&size=3Dsquare64" width=3D"64" hei= ght=3D"64" style=3D"display: block;"></td><td colspan=3D"1" valign=3D"top" = height=3D"0" width=3D"16" style=3D"padding: 0; font-family: Arial, sans-ser= if; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldonco= llege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" s= tyle=3D"display: block;"></td></tr></table></td><td colspan=3D"1" valign=3D= "top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, san= s-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.shel= doncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D= "0" style=3D"display: block;"></td><td valign=3D"middle" style=3D"padding: = 0; font-family: Arial, sans-serif; font-size: 13px;"><table width=3D"100%" = style=3D"border-spacing: 0; border-width: 0; border-collapse: collapse;"><t= r><td style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;= "><a href=3D"https://iLinq.sheldoncollege.com/news/12628?ref=3Demail" class= =3D"title" style=3D"color: rgb(0, 41, 92); line-height: 24px; font-weight: = bold; font-size: 16px; text-decoration: none;">MOTHERS' NIGHT OUT - UPDATE = OF ARRANGEMENTS</a></td></tr><tr class=3D"underline"><td colspan=3D"1" vali= gn=3D"top" height=3D"8" width=3D"0" style=3D"padding: 0; font-family: Arial= , sans-serif; font-size: 13px; border-bottom: solid 1px rgb(255, 255, 255);= line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/ema= ils/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: blo= ck;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0= " style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; lin= e-height: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/= spacer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"= ></td></tr><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px;"><p style=3D"line-height: 20px; font-size: 13px; margin: 0;">= <em> Mar 10 by Miss Beth Cooper </em></p></td></tr><tr><td style=3D"padding= : 0; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"line-hei= ght: 20px; font-size: 13px; margin: 0;">Important timing update regarding t= he upcoming Mothers' Night Out on Saturday 20 March. Tickets are on sale no= w!</p></td></tr></table></td><td colspan=3D"1" valign=3D"top" height=3D"0" = width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; font-size:= 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/imag= es/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"displa= y: block;"></td></tr><tr class=3D""><td colspan=3D"4" valign=3D"top" height= =3D"12" width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 12px;"><img src=3D"https://iLinq.sheldoncollege= .com/images/emails/spacer.gif" height=3D"12" width=3D"0" border=3D"0" style= =3D"display: block;"></td></tr><tr class=3D"dark"><td colspan=3D"4" valign= =3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family: Arial,= sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https://iLinq= .sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width=3D"0" bor= der=3D"0" style=3D"display: block;"></td></tr><tr class=3D"dark"><td width= =3D"72" height=3D"64" valign=3D"top" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px;"><table style=3D"border-spacing: 0; border-= width: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-fam= ily: Arial, sans-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldon= college.com/storage/image.php?hash=3Dc9769954d32192c5208d41b8f22a7beee8f7bf= a2&size=3Dsquare64" width=3D"64" height=3D"64" style=3D"display: block;= "></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"16" style=3D"= padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0= px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif"= height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr>= </table></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" styl= e=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heig= ht: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer= .gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td>= <td valign=3D"middle" style=3D"padding: 0; font-family: Arial, sans-serif; = font-size: 13px;"><table width=3D"100%" style=3D"border-spacing: 0; border-= width: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-fam= ily: Arial, sans-serif; font-size: 13px;"><a href=3D"https://iLinq.sheldonc= ollege.com/news/12623?ref=3Demail" class=3D"title" style=3D"color: rgb(0, 4= 1, 92); line-height: 24px; font-weight: bold; font-size: 16px; text-decorat= ion: none;">ATOM PHOTO COMPETITION</a></td></tr><tr class=3D"underline"><td= colspan=3D"1" valign=3D"top" height=3D"8" width=3D"0" style=3D"padding: 0;= font-family: Arial, sans-serif; font-size: 13px; border-bottom: solid 1px = rgb(255, 255, 255); line-height: 8px;"><img src=3D"https://iLinq.sheldoncol= lege.com/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" st= yle=3D"display: block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" heig= ht=3D"4" width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px; line-height: 4px;"><img src=3D"https://iLinq.sheldoncollege= .com/images/emails/spacer.gif" height=3D"4" width=3D"0" border=3D"0" style= =3D"display: block;"></td></tr><tr><td style=3D"padding: 0; font-family: Ar= ial, sans-serif; font-size: 13px;"><p style=3D"line-height: 20px; font-size= : 13px; margin: 0;"><em> Mar 9 by Mrs Shirley Henderson </em></p></td></tr>= <tr><td style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13p= x;"><p style=3D"line-height: 20px; font-size: 13px; margin: 0;">The=C2= =A0<strong>ATOM Photo Comp</strong>=C2=A0is an initiative of Australian Tea= chers of Media (ATOM). It provides Australian and New=C2=A0Zealand student = and adult photographers with the opportunity to submit=C2=A0<strong>a folio= of three (3) photographs adhering to a theme</strong>, and win fantastic p= rizes in the process.</p></td></tr></table></td><td colspan=3D"1" valign=3D= "top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, san= s-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.shel= doncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D= "0" style=3D"display: block;"></td></tr><tr class=3D"dark"><td colspan=3D"4= " valign=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family= : Arial, sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https= ://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr></table></td></tr><= tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" style=3D"paddi= ng: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 4px;">= <img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" heig= ht=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></tab= le></td></tr><tr><td colspan=3D"2" valign=3D"top" height=3D"8" width=3D"0" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-= height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/sp= acer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block;"><= /td></tr></table></td><td colspan=3D"1" valign=3D"top" height=3D"0" width= =3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px= ; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/em= ails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: bl= ock;"></td></tr><tr class=3D"content" style=3D"background-color: white;"><t= d colspan=3D"3" valign=3D"top" height=3D"8" width=3D"0" style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px; line-height: 8px;"><img = src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D= "8" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></table></= td></tr><tr><td class=3D"footer" width=3D"640" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; width: 100%;"><table align=3D"cen= ter" width=3D"640" style=3D"border-spacing: 0; border-width: 0; border-coll= apse: collapse;"><tr><td colspan=3D"3" valign=3D"top" height=3D"16" width= =3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px= ; line-height: 16px;"><img src=3D"https://iLinq.sheldoncollege.com/images/e= mails/spacer.gif" height=3D"16" width=3D"0" border=3D"0" style=3D"display: = block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"0" width= =3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px= ; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/em= ails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: bl= ock;"></td><td width=3D"608" valign=3D"top" style=3D"padding: 0; font-famil= y: Arial, sans-serif; font-size: 13px;"><p style=3D"color: black; font-fami= ly: Arial, sans-serif; font-size: 11px; line-height: 18px; text-align: righ= t; margin: 0;">If you do not wish to receive these emails from Sheldon Coll= ege, please <a href=3D"http://iLinq.sheldoncollege.com/settings/messages" s= tyle=3D"color: rgb(0, 41, 92); text-decoration: underline;">unsubscribe</a>= . </p><p style=3D"color: black; font-family: Arial, sans-serif; font-size: = 11px; line-height: 18px; text-align: right; margin: 0;"> =C2=A9 2021 <a hre= f=3D"https://www.sheldoncollege.com" style=3D"color: rgb(0, 41, 92); text-d= ecoration: underline;">Sheldon College</a> \| <a href=3D"http://iLinq.sheldo= ncollege.com/policy" style=3D"color: rgb(0, 41, 92); text-decoration: under= line;">Guidelines of Use and Privacy Policy</a> \| <a href=3D"http://iLinq.s= heldoncollege.com/feedback" style=3D"color: rgb(0, 41, 92); text-decoration= : underline;">Support and Feedback</a></p></td><td colspan=3D"1" valign=3D"= top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans= -serif; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheld= oncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"= 0" style=3D"display: block;"></td></tr><tr><td colspan=3D"3" valign=3D"top"= height=3D"16" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-se= rif; font-size: 13px; line-height: 16px;"><img src=3D"https://iLinq.sheldon= college.com/images/emails/spacer.gif" height=3D"16" width=3D"0" border=3D"0= " style=3D"display: block;"></td></tr></table></td></tr></table></td></tr><= /table></body></html> --_=_swift_1615361419_a3ed6ecb31cb8601bfd237cbdf533265_=_--

| ver. 1.4 | Github | . | PHP 7.4.33 | Generation time: 0 | proxy | phpinfo | Settings