File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1615015855.M642627P4172.au6.voltdns.com,S=19782,W=20079:2,a
Back
Return-Path: <ilinq@sheldoncollege.com> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id OAvoJK8vQ2BMEAAATr7HEg (envelope-from <ilinq@sheldoncollege.com>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Sat, 06 Mar 2021 17:30:55 +1000 Return-path: <ilinq@sheldoncollege.com> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Sat, 06 Mar 2021 17:30:55 +1000 Received: from viclamta29p.bpe.bigpond.com ([203.38.21.93]:54294) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <ilinq@sheldoncollege.com>) id 1lIROm-00016t-5K for ianhamilton@seafoodwarehouse.com.au; Sat, 06 Mar 2021 17:30:55 +1000 Received: from extmail.bigpond.com ([10.10.26.4]) by viclafep29p-svc.bpe.nexus.telstra.com.au with ESMTP id <20210306073011.CYLA6510.viclafep29p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Sat, 6 Mar 2021 18:30:11 +1100 Received-SPF: pass (extmail.bigpond.com: domain sheldoncollege.com designates 203.100.4.140 as permitted sender) identity=mailfrom; receiver=extmail.bigpond.com; client-ip=203.100.4.140; envelope-from=ilinq@sheldoncollege.com; helo=mail.sheldoncollege.com; X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduledruddtjedgleekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpefkfffuhffvgggtsegrtdhjredttdejnecuhfhrohhmpefuhhgvlhguohhnucevohhllhgvghgvuceoihhlihhnqhesshhhvghlughonhgtohhllhgvghgvrdgtohhmqeenucggtffrrghtthgvrhhnpedtvdejhfejueehueetleffkefhveehteevieffveefgeeuueelffetfefhudefgfenucffohhmrghinhepshhhvghlughonhgtohhllhgvghgvrdgtohhmnecukfhppedvtdefrddutddtrdegrddugedtnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepmhgrihhlrdhshhgvlhguohhntgholhhlvghgvgdrtghomhdpihhnvghtpedvtdefrddutddtrdegrddugedtpdhmrghilhhfrhhomhepoehilhhinhhqsehshhgvlhguohhntgholhhlvghgvgdrtghomheqpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mail.sheldoncollege.com (203.100.4.140) by extmail.bigpond.com (5.8.420) id 5FE6CF1911F8FB20 for aussfdservices@bigpond.com; Sat, 6 Mar 2021 18:30:11 +1100 Received: from ilinq.sheldoncollege.com ([10.40.0.71]) by mail.sheldoncollege.com over TLS secured channel with Microsoft SMTPSVC(10.0.14393.0); Sat, 6 Mar 2021 17:30:06 +1000 Received: from iLinq.sheldoncollege.com (localhost [127.0.0.1]) by ilinq.sheldoncollege.com (Postfix) with ESMTP id 5CA383606F9 for <aussfdservices@bigpond.com>; Sat, 6 Mar 2021 17:30:06 +1000 (AEST) Message-ID: <041c09e2418acbef254fc098930973b9@swift.generated> Date: Sat, 06 Mar 2021 17:30:06 +1000 From: Sheldon College <ilinq@sheldoncollege.com> To: Mr Ian Hamilton <aussfdservices@bigpond.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="_=_swift_1615015806_60b24ad1654138dbe40d9d93e6e9c14d_=_" MessageID: <c70510534de96fdc60073e2b0077a073@alaressmailer> X-OriginalArrivalTime: 06 Mar 2021 07:30:06.0473 (UTC) FILETIME=[87C23F90:01D7125A] X-Spam-Status: Yes, score=8.3 X-Spam-Score: 83 X-Spam-Bar: ++++++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: [iLINQ] News WEEK 6, TERM 1 - FROM THE DIRECTOR OF ACADEMICS PRIMARY DESK [https://iLinq.sheldoncollege.com/news/12594?ref=email] Content analysis details: (8.3 points, 8.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.8 BAYES_50 BODY: Bayes spam probability is 40 to 60% [score: 0.5001] 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: sheldoncollege.com] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=ilinq%40sheldoncollege.com;ip=203.38.21.93;r=au6.voltdns.com] 0.0 HTML_IMAGE_RATIO_02 BODY: HTML has a low ratio of text to image area 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 0.0 HTML_MESSAGE BODY: HTML included in message 3.5 MSGID_HDR_MALF Has invalid message ID header X-Spam-Flag: YES Subject: ***SPAM*** Sheldon College News Digest --_=_swift_1615015806_60b24ad1654138dbe40d9d93e6e9c14d_=_ Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable =09=09[iLINQ] =09=09News =09=09 WEEK 6, TERM 1 - FROM THE DIRECTO= R OF ACADEMICS PRIMARY DESK [https://iLinq.sheldoncollege.com/news/12594?= ref=3Demail] _ Mar 6 by Mrs Susan Brook _ Important information p= ertaining to the conclusion of Week 6 and the commencement of Week 7. = If you do not wish to receive these emails from Sheldon College, pleas= e unsubscribe [http://iLinq.sheldoncollege.com/settings/messages]. = =C2=A9 2021 Sheldon College [https://www.sheldoncollege.com] | Guidelines= of Use and Privacy Policy [http://iLinq.sheldoncollege.com/policy] | S= upport and Feedback [http://iLinq.sheldoncollege.com/feedback] --_=_swift_1615015806_60b24ad1654138dbe40d9d93e6e9c14d_=_ Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org= /TR/xhtml1/DTD/xhtml1-strict.dtd"><html xmlns=3D"http://www.w3.org/1999/xht= ml"><head><meta http-equiv=3D"Content-Type" content=3D"text/html; charset= =3Dutf-8"><meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-= scale=3D1.0"><title>Sheldon College News Digest</title><style type=3D"text/= css"> /* This file is subject to Twig, beware the */ /* use classes, don't = use id's */ /* will be truncated by mail clients, but we use it for styling= */ body { margin: 0; } table { border-spacing: 0; border-width: 0; border-= collapse: collapse; } td { padding: 0; font-family: Arial, sans-serif; font= -size: 13px; } a { text-decoration: none; } a[href] { text-decoration: unde= rline; } img { display: block; } .wrap { width: 100%; } .inner-wrap { backg= round-color: rgb(235, 237, 237); width: 100%; } .header, .footer { width: 1= 00%; } .header { background-color: rgb(235, 237, 237); } .header img { colo= r: rgb(0, 41, 92) } .content { background-color: white; } .content a { colo= r: rgb(0, 41, 92); } .content p { line-height: 20px; font-size: 13px; margi= n: 0; } .content .heading { line-height: 36px; font-weight: bold; font-size= : 18px; color: rgb(255, 255, 255); } .content a.cta { background-color: rgb= (255, 255, 255); padding: 4px 8px 6px; text-decoration: none; color: rgb(0,= 41, 92); } .content .title { line-height: 24px; font-weight: bold; font-si= ze: 16px; text-decoration: none; } .footer p { color: black; font-family: A= rial, sans-serif; font-size: 11px; line-height: 18px; text-align: right; ma= rgin: 0; } .footer a { color: rgb(0, 41, 92); text-decoration: underline; }= tr.underline td, td.underline { border-bottom: solid 1px rgb(255, 255, 255= ); } .work-month, .work-day { text-align: center; border: solid 2px rgb(255= , 255, 255); } .work-month { text-transform: uppercase; font-size: 12px; ba= ckground-color: rgb(255, 255, 255); color: rgb(51, 84, 125); border-bottom:= solid 1px #fff; } .work-day { font-size: 22px; line-height: 35px; color: r= gb(255, 255, 255); background-color: rgb(0, 41, 92); } </style></head><body= style=3D"margin: 0;"><table class=3D"wrap" style=3D"border-spacing: 0; bor= der-width: 0; border-collapse: collapse; width: 100%;"><tr><td style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table class=3D"= inner-wrap" style=3D"border-spacing: 0; border-width: 0; border-collapse: c= ollapse; background-color: rgb(235, 237, 237); width: 100%;"><tr height=3D"= 90"><td class=3D"header" style=3D"padding: 0; font-family: Arial, sans-seri= f; font-size: 13px; width: 100%; background-color: rgb(235, 237, 237);"><ta= ble align=3D"center" width=3D"640" style=3D"border-spacing: 0; border-width= : 0; border-collapse: collapse;"><tr><td colspan=3D"3" valign=3D"top" heigh= t=3D"8" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.= com/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style= =3D"display: block; color: rgb(0, 41, 92);"></td></tr><tr><td colspan=3D"1"= valign=3D"top" height=3D"32" width=3D"4" style=3D"padding: 0; font-family:= Arial, sans-serif; font-size: 13px; line-height: 32px;"><img src=3D"https:= //iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"32" width=3D= "0" border=3D"0" style=3D"display: block; color: rgb(0, 41, 92);"></td><td = colspan=3D"2" valign=3D"middle" style=3D"padding: 0; font-family: Arial, sa= ns-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncollege.com/im= ages/logo.php?logo=3Dskin_logo_square&size=3Dnormal" alt=3D"iLINQ" bord= er=3D"0" height=3D"72" style=3D"display: block; color: rgb(0, 41, 92);"></t= d></tr><tr><td colspan=3D"3" valign=3D"top" height=3D"8" width=3D"4" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block; color: = rgb(0, 41, 92);"></td></tr></table></td></tr><tr><td class=3D"content" styl= e=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; backgroun= d-color: white;"><table align=3D"center" width=3D"640" style=3D"border-spac= ing: 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"1" = valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: A= rial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://i= Linq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" = border=3D"0" style=3D"display: block;"></td><td style=3D"padding: 0; font-f= amily: Arial, sans-serif; font-size: 13px;"><table style=3D"border-spacing:= 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"3" vali= gn=3D"top" height=3D"16" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 16px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"16" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D"heading" style= =3D"line-height: 36px; font-weight: bold; font-size: 18px; color: rgb(255, = 255, 255);"><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td class=3D"heading" valign=3D"middle" height=3D"32" style=3D"padding: 0; f= ont-family: Arial, sans-serif; line-height: 36px; font-weight: bold; font-s= ize: 18px; color: rgb(255, 255, 255);">News</td></tr><tr><td colspan=3D"2" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><tab= le width=3D"624" style=3D"border-spacing: 0; border-width: 0; border-collap= se: collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif;= font-size: 13px;"><table width=3D"624" style=3D"border-spacing: 0; border-= width: 0; border-collapse: collapse;"><tr class=3D""><td colspan=3D"4" vali= gn=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><td width=3D= "72" height=3D"64" valign=3D"top" style=3D"padding: 0; font-family: Arial, = sans-serif; font-size: 13px;"><table style=3D"border-spacing: 0; border-wid= th: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-family= : Arial, sans-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncol= lege.com/storage/image.php?hash=3D27440f0c99be4ff69576649d48c8f1bf855aeeb4&= amp;size=3Dsquare64" width=3D"64" height=3D"64" style=3D"display: block;"><= /td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"16" style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0px;= "><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" he= ight=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></t= able></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td valign=3D"middle" style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px;"><table width=3D"100%" style=3D"border-spacing: 0; border-w= idth: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-fami= ly: Arial, sans-serif; font-size: 13px;"><a href=3D"https://iLinq.sheldonco= llege.com/news/12594?ref=3Demail" class=3D"title" style=3D"color: rgb(0, 41= , 92); line-height: 24px; font-weight: bold; font-size: 16px; text-decorati= on: none;"> WEEK 6, TERM 1 - FROM THE DIRECTOR OF ACADEMICS PRIMARY DESK</a= ></td></tr><tr class=3D"underline"><td colspan=3D"1" valign=3D"top" height= =3D"8" width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; border-bottom: solid 1px rgb(255, 255, 255); line-height: 8px= ;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" h= eight=3D"8" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><t= r><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" style=3D"paddin= g: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 4px;"><= img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" heigh= t=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr><t= d style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><p= style=3D"line-height: 20px; font-size: 13px; margin: 0;"><em> Mar 6 by Mrs= Susan Brook </em></p></td></tr><tr><td style=3D"padding: 0; font-family: A= rial, sans-serif; font-size: 13px;"><p style=3D"line-height: 20px; font-siz= e: 13px; margin: 0;">Important information pertaining to the conclusion of = Week 6 and the commencement of Week 7.</p></td></tr></table></td><td colspa= n=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-f= amily: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"h= ttps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" widt= h=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><td= colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px; line-height: 12px;"><img= src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height= =3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></tabl= e></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" s= tyle=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-h= eight: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spa= cer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"></= td></tr></table></td></tr><tr><td colspan=3D"2" valign=3D"top" height=3D"8"= width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size= : 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/ima= ges/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"displ= ay: block;"></td></tr></table></td><td colspan=3D"1" valign=3D"top" height= =3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D= "display: block;"></td></tr><tr class=3D"content" style=3D"background-color= : white;"><td colspan=3D"3" valign=3D"top" height=3D"8" width=3D"0" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block;"></td><= /tr></table></td></tr><tr><td class=3D"footer" width=3D"640" style=3D"paddi= ng: 0; font-family: Arial, sans-serif; font-size: 13px; width: 100%;"><tabl= e align=3D"center" width=3D"640" style=3D"border-spacing: 0; border-width: = 0; border-collapse: collapse;"><tr><td colspan=3D"3" valign=3D"top" height= =3D"16" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 16px;"><img src=3D"https://iLinq.sheldoncollege= .com/images/emails/spacer.gif" height=3D"16" width=3D"0" border=3D"0" style= =3D"display: block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height= =3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D= "display: block;"></td><td width=3D"608" valign=3D"top" style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"color: blac= k; font-family: Arial, sans-serif; font-size: 11px; line-height: 18px; text= -align: right; margin: 0;">If you do not wish to receive these emails from = Sheldon College, please <a href=3D"http://iLinq.sheldoncollege.com/settings= /messages" style=3D"color: rgb(0, 41, 92); text-decoration: underline;">uns= ubscribe</a>. </p><p style=3D"color: black; font-family: Arial, sans-serif;= font-size: 11px; line-height: 18px; text-align: right; margin: 0;"> =C2= =A9 2021 <a href=3D"https://www.sheldoncollege.com" style=3D"color: rgb(0, = 41, 92); text-decoration: underline;">Sheldon College</a> | <a href=3D"http= ://iLinq.sheldoncollege.com/policy" style=3D"color: rgb(0, 41, 92); text-de= coration: underline;">Guidelines of Use and Privacy Policy</a> | <a href=3D= "http://iLinq.sheldoncollege.com/feedback" style=3D"color: rgb(0, 41, 92); = text-decoration: underline;">Support and Feedback</a></p></td><td colspan= =3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"ht= tps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr><td colspan=3D"= 3" valign=3D"top" height=3D"16" width=3D"4" style=3D"padding: 0; font-famil= y: Arial, sans-serif; font-size: 13px; line-height: 16px;"><img src=3D"http= s://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"16" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr></table></td></tr><= /table></td></tr></table></body></html> --_=_swift_1615015806_60b24ad1654138dbe40d9d93e6e9c14d_=_--
| ver. 1.4 |
Github
|
.
| PHP 7.4.33 | Generation time: 0 |
proxy
|
phpinfo
|
Settings