File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1614670325.M539123P5532.au6.voltdns.com,S=32309,W=32792:2,a
Back
Return-Path: <ilinq@sheldoncollege.com> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id EOgFIPXpPWCcFQAATr7HEg (envelope-from <ilinq@sheldoncollege.com>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Tue, 02 Mar 2021 17:32:05 +1000 Return-path: <ilinq@sheldoncollege.com> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Tue, 02 Mar 2021 17:32:05 +1000 Received: from viclamta34p.bpe.bigpond.com ([203.38.21.98]:46118) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <ilinq@sheldoncollege.com>) id 1lGzVi-0001Qt-3m for ianhamilton@seafoodwarehouse.com.au; Tue, 02 Mar 2021 17:32:05 +1000 Received: from extmail.bigpond.com ([10.10.26.4]) by viclafep34p-svc.bpe.nexus.telstra.com.au with ESMTP id <20210302073121.VKNE9964.viclafep34p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Tue, 2 Mar 2021 18:31:21 +1100 Received-SPF: pass (extmail.bigpond.com: domain sheldoncollege.com designates 203.100.4.140 as permitted sender) identity=mailfrom; receiver=extmail.bigpond.com; client-ip=203.100.4.140; envelope-from=ilinq@sheldoncollege.com; helo=mail.sheldoncollege.com; X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduledrleelgddutdelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpefkfffuhffvgggtsegrtdhjredttdejnecuhfhrohhmpefuhhgvlhguohhnucevohhllhgvghgvuceoihhlihhnqhesshhhvghlughonhgtohhllhgvghgvrdgtohhmqeenucggtffrrghtthgvrhhnpedtvdejhfejueehueetleffkefhveehteevieffveefgeeuueelffetfefhudefgfenucffohhmrghinhepshhhvghlughonhgtohhllhgvghgvrdgtohhmnecukfhppedvtdefrddutddtrdegrddugedtnecuvehluhhsthgvrhfuihiivgepheenucfrrghrrghmpehhvghlohepmhgrihhlrdhshhgvlhguohhntgholhhlvghgvgdrtghomhdpihhnvghtpedvtdefrddutddtrdegrddugedtpdhmrghilhhfrhhomhepoehilhhinhhqsehshhgvlhguohhntgholhhlvghgvgdrtghomheqpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mail.sheldoncollege.com (203.100.4.140) by extmail.bigpond.com (5.8.420) id 602A5B5D046043AE for aussfdservices@bigpond.com; Tue, 2 Mar 2021 18:31:18 +1100 Received: from ilinq.sheldoncollege.com ([10.40.0.71]) by mail.sheldoncollege.com over TLS secured channel with Microsoft SMTPSVC(10.0.14393.0); Tue, 2 Mar 2021 17:30:17 +1000 Received: from iLinq.sheldoncollege.com (localhost [127.0.0.1]) by ilinq.sheldoncollege.com (Postfix) with ESMTP id 2FDD4360236 for <aussfdservices@bigpond.com>; Tue, 2 Mar 2021 17:30:17 +1000 (AEST) Message-ID: <28e1af941b2e3902b1ee5a19fede725e@swift.generated> Date: Tue, 02 Mar 2021 17:30:17 +1000 From: Sheldon College <ilinq@sheldoncollege.com> To: Mr Ian Hamilton <aussfdservices@bigpond.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="_=_swift_1614670217_c748f5261860049c8d9488623e4f7deb_=_" MessageID: <c858b95f4003e92dd20f5a333f1ef5e4@alaressmailer> X-OriginalArrivalTime: 02 Mar 2021 07:30:17.0313 (UTC) FILETIME=[E4914D10:01D70F35] X-Spam-Status: Yes, score=8.3 X-Spam-Score: 83 X-Spam-Bar: ++++++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: [iLINQ] News "OUR PLACE" VACATION CARE BOOKINGS - APRIL 2021 [https://iLinq.sheldoncollege.com/news/12550?ref=email] Content analysis details: (8.3 points, 8.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: sheldoncollege.com] 0.8 BAYES_50 BODY: Bayes spam probability is 40 to 60% [score: 0.5000] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=ilinq%40sheldoncollege.com;ip=203.38.21.98;r=au6.voltdns.com] 0.0 HTML_IMAGE_RATIO_02 BODY: HTML has a low ratio of text to image area 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 0.0 HTML_MESSAGE BODY: HTML included in message 3.5 MSGID_HDR_MALF Has invalid message ID header X-Spam-Flag: YES Subject: ***SPAM*** Sheldon College News Digest --_=_swift_1614670217_c748f5261860049c8d9488623e4f7deb_=_ Content-Type: text/plain; charset=utf-8 Content-Transfer-Encoding: quoted-printable =09=09[iLINQ] =09=09News =09=09"OUR PLACE" VACATION CARE BOOKINGS= - APRIL 2021 [https://iLinq.sheldoncollege.com/news/12550?ref=3Demail]= _ Mar 2 by Mrs Susie Coleman _ Secure your place at Vacation Car= e for the upcoming holidays - bookings are=C2=A0now open for students in = Prep onwards. =09=09WEEK 6 UPDATE FOR YEAR 7 [https://iLinq.sheldonc= ollege.com/news/12541?ref=3Demail] _ Mar 2 by Mr Joshua McHugh _ = Week 6 Update =09=09BUSH DANCE REMINDER - FINAL DAYS TO PURCHASE RIDE = BRACELETS [https://iLinq.sheldoncollege.com/news/12535?ref=3Demail] = _ Mar 2 by Mrs Louise Thomsen _ Only 2 days=C2=A0left to purchase your= discounted ride bracelet online and information regarding the upcoming B= ush Dance. =09=09Activity Mrs Sharon Collis [https://iLinq.sheldo= ncollege.com/search/user/5649] blogged about Lesson 4 [https://iLinq.shel= doncollege.com/blog/20200] in Aiesha Hamilton - Piano Lesson [https://i= Linq.sheldoncollege.com/homepage/19987] If you do not wish to receive = these emails from Sheldon College, please unsubscribe [http://iLinq.she= ldoncollege.com/settings/messages]. =C2=A9 2021 Sheldon College [https= ://www.sheldoncollege.com] | Guidelines of Use and Privacy Policy [http:/= /iLinq.sheldoncollege.com/policy] | Support and Feedback [http://iLinq.sh= eldoncollege.com/feedback] --_=_swift_1614670217_c748f5261860049c8d9488623e4f7deb_=_ Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org= /TR/xhtml1/DTD/xhtml1-strict.dtd"><html xmlns=3D"http://www.w3.org/1999/xht= ml"><head><meta http-equiv=3D"Content-Type" content=3D"text/html; charset= =3Dutf-8"><meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-= scale=3D1.0"><title>Sheldon College News Digest</title><style type=3D"text/= css"> /* This file is subject to Twig, beware the */ /* use classes, don't = use id's */ /* will be truncated by mail clients, but we use it for styling= */ body { margin: 0; } table { border-spacing: 0; border-width: 0; border-= collapse: collapse; } td { padding: 0; font-family: Arial, sans-serif; font= -size: 13px; } a { text-decoration: none; } a[href] { text-decoration: unde= rline; } img { display: block; } .wrap { width: 100%; } .inner-wrap { backg= round-color: rgb(235, 237, 237); width: 100%; } .header, .footer { width: 1= 00%; } .header { background-color: rgb(235, 237, 237); } .header img { colo= r: rgb(0, 41, 92) } .content { background-color: white; } .content a { colo= r: rgb(0, 41, 92); } .content p { line-height: 20px; font-size: 13px; margi= n: 0; } .content .heading { line-height: 36px; font-weight: bold; font-size= : 18px; color: rgb(255, 255, 255); } .content a.cta { background-color: rgb= (255, 255, 255); padding: 4px 8px 6px; text-decoration: none; color: rgb(0,= 41, 92); } .content .title { line-height: 24px; font-weight: bold; font-si= ze: 16px; text-decoration: none; } .footer p { color: black; font-family: A= rial, sans-serif; font-size: 11px; line-height: 18px; text-align: right; ma= rgin: 0; } .footer a { color: rgb(0, 41, 92); text-decoration: underline; }= tr.underline td, td.underline { border-bottom: solid 1px rgb(255, 255, 255= ); } .work-month, .work-day { text-align: center; border: solid 2px rgb(255= , 255, 255); } .work-month { text-transform: uppercase; font-size: 12px; ba= ckground-color: rgb(255, 255, 255); color: rgb(51, 84, 125); border-bottom:= solid 1px #fff; } .work-day { font-size: 22px; line-height: 35px; color: r= gb(255, 255, 255); background-color: rgb(0, 41, 92); } </style></head><body= style=3D"margin: 0;"><table class=3D"wrap" style=3D"border-spacing: 0; bor= der-width: 0; border-collapse: collapse; width: 100%;"><tr><td style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table class=3D"= inner-wrap" style=3D"border-spacing: 0; border-width: 0; border-collapse: c= ollapse; background-color: rgb(235, 237, 237); width: 100%;"><tr height=3D"= 90"><td class=3D"header" style=3D"padding: 0; font-family: Arial, sans-seri= f; font-size: 13px; width: 100%; background-color: rgb(235, 237, 237);"><ta= ble align=3D"center" width=3D"640" style=3D"border-spacing: 0; border-width= : 0; border-collapse: collapse;"><tr><td colspan=3D"3" valign=3D"top" heigh= t=3D"8" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.= com/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style= =3D"display: block; color: rgb(0, 41, 92);"></td></tr><tr><td colspan=3D"1"= valign=3D"top" height=3D"32" width=3D"4" style=3D"padding: 0; font-family:= Arial, sans-serif; font-size: 13px; line-height: 32px;"><img src=3D"https:= //iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"32" width=3D= "0" border=3D"0" style=3D"display: block; color: rgb(0, 41, 92);"></td><td = colspan=3D"2" valign=3D"middle" style=3D"padding: 0; font-family: Arial, sa= ns-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncollege.com/im= ages/logo.php?logo=3Dskin_logo_square&size=3Dnormal" alt=3D"iLINQ" bord= er=3D"0" height=3D"72" style=3D"display: block; color: rgb(0, 41, 92);"></t= d></tr><tr><td colspan=3D"3" valign=3D"top" height=3D"8" width=3D"4" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block; color: = rgb(0, 41, 92);"></td></tr></table></td></tr><tr><td class=3D"content" styl= e=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; backgroun= d-color: white;"><table align=3D"center" width=3D"640" style=3D"border-spac= ing: 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"1" = valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: A= rial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://i= Linq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" = border=3D"0" style=3D"display: block;"></td><td style=3D"padding: 0; font-f= amily: Arial, sans-serif; font-size: 13px;"><table style=3D"border-spacing:= 0; border-width: 0; border-collapse: collapse;"><tr><td colspan=3D"3" vali= gn=3D"top" height=3D"16" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 16px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"16" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D"heading" style= =3D"line-height: 36px; font-weight: bold; font-size: 18px; color: rgb(255, = 255, 255);"><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td class=3D"heading" valign=3D"middle" height=3D"32" style=3D"padding: 0; f= ont-family: Arial, sans-serif; line-height: 36px; font-weight: bold; font-s= ize: 18px; color: rgb(255, 255, 255);">News</td></tr><tr><td colspan=3D"2" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><tab= le width=3D"624" style=3D"border-spacing: 0; border-width: 0; border-collap= se: collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif;= font-size: 13px;"><table width=3D"624" style=3D"border-spacing: 0; border-= width: 0; border-collapse: collapse;"><tr class=3D""><td colspan=3D"4" vali= gn=3D"top" height=3D"12" width=3D"0" style=3D"padding: 0; font-family: Aria= l, sans-serif; font-size: 13px; line-height: 12px;"><img src=3D"https://iLi= nq.sheldoncollege.com/images/emails/spacer.gif" height=3D"12" width=3D"0" b= order=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><td width=3D= "72" height=3D"64" valign=3D"top" style=3D"padding: 0; font-family: Arial, = sans-serif; font-size: 13px;"><table style=3D"border-spacing: 0; border-wid= th: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-family= : Arial, sans-serif; font-size: 13px;"><img src=3D"https://iLinq.sheldoncol= lege.com/storage/image.php?hash=3Db987cc37c201d9b42ad496268432f4a3b34f5289&= amp;size=3Dsquare64" width=3D"64" height=3D"64" style=3D"display: block;"><= /td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"16" style=3D"pad= ding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0px;= "><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" he= ight=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></t= able></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td><= td valign=3D"middle" style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px;"><table width=3D"100%" style=3D"border-spacing: 0; border-w= idth: 0; border-collapse: collapse;"><tr><td style=3D"padding: 0; font-fami= ly: Arial, sans-serif; font-size: 13px;"><a href=3D"https://iLinq.sheldonco= llege.com/news/12550?ref=3Demail" class=3D"title" style=3D"color: rgb(0, 41= , 92); line-height: 24px; font-weight: bold; font-size: 16px; text-decorati= on: none;">"OUR PLACE" VACATION CARE BOOKINGS - APRIL 2021</a></td></tr><tr= class=3D"underline"><td colspan=3D"1" valign=3D"top" height=3D"8" width=3D= "0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; b= order-bottom: solid 1px rgb(255, 255, 255); line-height: 8px;"><img src=3D"= https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"8" wid= th=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr><td colspan= =3D"1" valign=3D"top" height=3D"4" width=3D"0" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; line-height: 4px;"><img src=3D"ht= tps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"4" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr><td style=3D"pa= dding: 0; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"lin= e-height: 20px; font-size: 13px; margin: 0;"><em> Mar 2 by Mrs Susie Colema= n </em></p></td></tr><tr><td style=3D"padding: 0; font-family: Arial, sans-= serif; font-size: 13px;"><p style=3D"line-height: 20px; font-size: 13px; ma= rgin: 0;">Secure your place at Vacation Care for the upcoming holidays - bo= okings are=C2=A0now open for students in Prep onwards.</p></td></tr></table= ></td><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"pa= dding: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0px= ;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" h= eight=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><t= r class=3D""><td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" sty= le=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-hei= ght: 12px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spac= er.gif" height=3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></= td></tr><tr class=3D"dark"><td colspan=3D"4" valign=3D"top" height=3D"12" w= idth=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: = 13px; line-height: 12px;"><img src=3D"https://iLinq.sheldoncollege.com/imag= es/emails/spacer.gif" height=3D"12" width=3D"0" border=3D"0" style=3D"displ= ay: block;"></td></tr><tr class=3D"dark"><td width=3D"72" height=3D"64" val= ign=3D"top" style=3D"padding: 0; font-family: Arial, sans-serif; font-size:= 13px;"><table style=3D"border-spacing: 0; border-width: 0; border-collapse= : collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; f= ont-size: 13px;"><img src=3D"https://iLinq.sheldoncollege.com/storage/image= .php?hash=3D99741226e9a9294cac34eaadbc4c778ae2b3c8fc&size=3Dsquare64" w= idth=3D"64" height=3D"64" style=3D"display: block;"></td><td colspan=3D"1" = valign=3D"top" height=3D"0" width=3D"16" style=3D"padding: 0; font-family: = Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://= iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0"= border=3D"0" style=3D"display: block;"></td></tr></table></td><td colspan= =3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"ht= tps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width= =3D"0" border=3D"0" style=3D"display: block;"></td><td valign=3D"middle" st= yle=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table= width=3D"100%" style=3D"border-spacing: 0; border-width: 0; border-collaps= e: collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; = font-size: 13px;"><a href=3D"https://iLinq.sheldoncollege.com/news/12541?re= f=3Demail" class=3D"title" style=3D"color: rgb(0, 41, 92); line-height: 24p= x; font-weight: bold; font-size: 16px; text-decoration: none;">WEEK 6 UPDAT= E FOR YEAR 7</a></td></tr><tr class=3D"underline"><td colspan=3D"1" valign= =3D"top" height=3D"8" width=3D"0" style=3D"padding: 0; font-family: Arial, = sans-serif; font-size: 13px; border-bottom: solid 1px rgb(255, 255, 255); l= ine-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/email= s/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block= ;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" = style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-= height: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/sp= acer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"><= /td></tr><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; font-= size: 13px;"><p style=3D"line-height: 20px; font-size: 13px; margin: 0;"><e= m> Mar 2 by Mr Joshua McHugh </em></p></td></tr><tr><td style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"line-height= : 20px; font-size: 13px; margin: 0;">Week 6 Update</p></td></tr></table></t= d><td colspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"paddin= g: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 0px;"><= img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" heigh= t=3D"0" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr cl= ass=3D"dark"><td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" sty= le=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-hei= ght: 12px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spac= er.gif" height=3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></= td></tr><tr class=3D""><td colspan=3D"4" valign=3D"top" height=3D"12" width= =3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px= ; line-height: 12px;"><img src=3D"https://iLinq.sheldoncollege.com/images/e= mails/spacer.gif" height=3D"12" width=3D"0" border=3D"0" style=3D"display: = block;"></td></tr><tr class=3D""><td width=3D"72" height=3D"64" valign=3D"t= op" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;">= <table style=3D"border-spacing: 0; border-width: 0; border-collapse: collap= se;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; font-size= : 13px;"><img src=3D"https://iLinq.sheldoncollege.com/storage/image.php?has= h=3D5cb45d5e1b8b90c9622f103287ad7f5def26aa8c&size=3Dsquare64" width=3D"= 64" height=3D"64" style=3D"display: block;"></td><td colspan=3D"1" valign= =3D"top" height=3D"0" width=3D"16" style=3D"padding: 0; font-family: Arial,= sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.= sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" borde= r=3D"0" style=3D"display: block;"></td></tr></table></td><td colspan=3D"1" = valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-family: A= rial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"https://i= Linq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width=3D"0" = border=3D"0" style=3D"display: block;"></td><td valign=3D"middle" style=3D"= padding: 0; font-family: Arial, sans-serif; font-size: 13px;"><table width= =3D"100%" style=3D"border-spacing: 0; border-width: 0; border-collapse: col= lapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; font-s= ize: 13px;"><a href=3D"https://iLinq.sheldoncollege.com/news/12535?ref=3Dem= ail" class=3D"title" style=3D"color: rgb(0, 41, 92); line-height: 24px; fon= t-weight: bold; font-size: 16px; text-decoration: none;">BUSH DANCE REMINDE= R - FINAL DAYS TO PURCHASE RIDE BRACELETS</a></td></tr><tr class=3D"underli= ne"><td colspan=3D"1" valign=3D"top" height=3D"8" width=3D"0" style=3D"padd= ing: 0; font-family: Arial, sans-serif; font-size: 13px; border-bottom: sol= id 1px rgb(255, 255, 255); line-height: 8px;"><img src=3D"https://iLinq.she= ldoncollege.com/images/emails/spacer.gif" height=3D"8" width=3D"0" border= =3D"0" style=3D"display: block;"></td></tr><tr><td colspan=3D"1" valign=3D"= top" height=3D"4" width=3D"0" style=3D"padding: 0; font-family: Arial, sans= -serif; font-size: 13px; line-height: 4px;"><img src=3D"https://iLinq.sheld= oncollege.com/images/emails/spacer.gif" height=3D"4" width=3D"0" border=3D"= 0" style=3D"display: block;"></td></tr><tr><td style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px;"><p style=3D"line-height: 20px; f= ont-size: 13px; margin: 0;"><em> Mar 2 by Mrs Louise Thomsen </em></p></td>= </tr><tr><td style=3D"padding: 0; font-family: Arial, sans-serif; font-size= : 13px;"><p style=3D"line-height: 20px; font-size: 13px; margin: 0;">Only 2= days=C2=A0left to purchase your discounted ride bracelet online and inform= ation regarding the upcoming Bush Dance.</p></td></tr></table></td><td cols= pan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font= -family: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D= "https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" wi= dth=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr class=3D""><= td colspan=3D"4" valign=3D"top" height=3D"12" width=3D"0" style=3D"padding:= 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 12px;"><i= mg src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height= =3D"12" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></tabl= e></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" s= tyle=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-h= eight: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spa= cer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"></= td></tr></table></td></tr><tr><td colspan=3D"3" valign=3D"top" height=3D"16= " width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-siz= e: 13px; line-height: 16px;"><img src=3D"https://iLinq.sheldoncollege.com/i= mages/emails/spacer.gif" height=3D"16" width=3D"0" border=3D"0" style=3D"di= splay: block;"></td></tr><tr class=3D"heading" style=3D"line-height: 36px; = font-weight: bold; font-size: 18px; color: rgb(255, 255, 255);"><td colspan= =3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"ht= tps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width= =3D"0" border=3D"0" style=3D"display: block;"></td><td class=3D"heading" va= lign=3D"middle" height=3D"32" style=3D"padding: 0; font-family: Arial, sans= -serif; line-height: 36px; font-weight: bold; font-size: 18px; color: rgb(2= 55, 255, 255);">Activity</td></tr><tr><td colspan=3D"2" style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px;"><table width=3D"624" st= yle=3D"border-spacing: 0; border-width: 0; border-collapse: collapse;"><tr>= <td style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px;">= <table width=3D"624" style=3D"border-spacing: 0; border-width: 0; border-co= llapse: collapse;"><tr class=3D""><td colspan=3D"4" valign=3D"top" height= =3D"8" width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D= "display: block;"></td></tr><tr class=3D""><td width=3D"32" height=3D"32" v= align=3D"top" style=3D"padding: 0; font-family: Arial, sans-serif; font-siz= e: 13px;"><table style=3D"border-spacing: 0; border-width: 0; border-collap= se: collapse;"><tr><td style=3D"padding: 0; font-family: Arial, sans-serif;= font-size: 13px;"><img src=3D"https://iLinq.sheldoncollege.com/images/icon= .php?size=3D64&icon=3Dhomepage_blog" width=3D"32" height=3D"32" style= =3D"display: block;"></td><td colspan=3D"1" valign=3D"top" height=3D"0" wid= th=3D"16" style=3D"padding: 0; font-family: Arial, sans-serif; font-size: 1= 3px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/images= /emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"display:= block;"></td></tr></table></td><td colspan=3D"1" valign=3D"top" height=3D"= 0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; font-si= ze: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.com/i= mages/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D"dis= play: block;"></td><td valign=3D"middle" style=3D"padding: 0; font-family: = Arial, sans-serif; font-size: 13px;"><table width=3D"100%" style=3D"border-= spacing: 0; border-width: 0; border-collapse: collapse;"><tr><td style=3D"p= adding: 0; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"li= ne-height: 20px; font-size: 13px; margin: 0;"><a href=3D"https://iLinq.shel= doncollege.com/search/user/5649" style=3D"text-decoration: underline; color= : rgb(0, 41, 92);">Mrs Sharon Collis</a> blogged about <a href=3D"https://i= Linq.sheldoncollege.com/blog/20200" style=3D"text-decoration: underline; co= lor: rgb(0, 41, 92);">Lesson 4</a> in <a href=3D"https://iLinq.sheldoncolle= ge.com/homepage/19987" style=3D"text-decoration: underline; color: rgb(0, 4= 1, 92);">Aiesha Hamilton - Piano Lesson</a></p></td></tr></table></td><td c= olspan=3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; f= ont-family: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src= =3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0"= width=3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr class=3D"= "><td colspan=3D"4" valign=3D"top" height=3D"8" width=3D"0" style=3D"paddin= g: 0; font-family: Arial, sans-serif; font-size: 13px; line-height: 8px;"><= img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.gif" heigh= t=3D"8" width=3D"0" border=3D"0" style=3D"display: block;"></td></tr></tabl= e></td></tr><tr><td colspan=3D"1" valign=3D"top" height=3D"4" width=3D"0" s= tyle=3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-h= eight: 4px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spa= cer.gif" height=3D"4" width=3D"0" border=3D"0" style=3D"display: block;"></= td></tr></table></td></tr><tr><td colspan=3D"2" valign=3D"top" height=3D"8"= width=3D"0" style=3D"padding: 0; font-family: Arial, sans-serif; font-size= : 13px; line-height: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/ima= ges/emails/spacer.gif" height=3D"8" width=3D"0" border=3D"0" style=3D"displ= ay: block;"></td></tr></table></td><td colspan=3D"1" valign=3D"top" height= =3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D= "display: block;"></td></tr><tr class=3D"content" style=3D"background-color= : white;"><td colspan=3D"3" valign=3D"top" height=3D"8" width=3D"0" style= =3D"padding: 0; font-family: Arial, sans-serif; font-size: 13px; line-heigh= t: 8px;"><img src=3D"https://iLinq.sheldoncollege.com/images/emails/spacer.= gif" height=3D"8" width=3D"0" border=3D"0" style=3D"display: block;"></td><= /tr></table></td></tr><tr><td class=3D"footer" width=3D"640" style=3D"paddi= ng: 0; font-family: Arial, sans-serif; font-size: 13px; width: 100%;"><tabl= e align=3D"center" width=3D"640" style=3D"border-spacing: 0; border-width: = 0; border-collapse: collapse;"><tr><td colspan=3D"3" valign=3D"top" height= =3D"16" width=3D"4" style=3D"padding: 0; font-family: Arial, sans-serif; fo= nt-size: 13px; line-height: 16px;"><img src=3D"https://iLinq.sheldoncollege= .com/images/emails/spacer.gif" height=3D"16" width=3D"0" border=3D"0" style= =3D"display: block;"></td></tr><tr><td colspan=3D"1" valign=3D"top" height= =3D"0" width=3D"8" style=3D"padding: 0; font-family: Arial, sans-serif; fon= t-size: 13px; line-height: 0px;"><img src=3D"https://iLinq.sheldoncollege.c= om/images/emails/spacer.gif" height=3D"0" width=3D"0" border=3D"0" style=3D= "display: block;"></td><td width=3D"608" valign=3D"top" style=3D"padding: 0= ; font-family: Arial, sans-serif; font-size: 13px;"><p style=3D"color: blac= k; font-family: Arial, sans-serif; font-size: 11px; line-height: 18px; text= -align: right; margin: 0;">If you do not wish to receive these emails from = Sheldon College, please <a href=3D"http://iLinq.sheldoncollege.com/settings= /messages" style=3D"color: rgb(0, 41, 92); text-decoration: underline;">uns= ubscribe</a>. </p><p style=3D"color: black; font-family: Arial, sans-serif;= font-size: 11px; line-height: 18px; text-align: right; margin: 0;"> =C2= =A9 2021 <a href=3D"https://www.sheldoncollege.com" style=3D"color: rgb(0, = 41, 92); text-decoration: underline;">Sheldon College</a> | <a href=3D"http= ://iLinq.sheldoncollege.com/policy" style=3D"color: rgb(0, 41, 92); text-de= coration: underline;">Guidelines of Use and Privacy Policy</a> | <a href=3D= "http://iLinq.sheldoncollege.com/feedback" style=3D"color: rgb(0, 41, 92); = text-decoration: underline;">Support and Feedback</a></p></td><td colspan= =3D"1" valign=3D"top" height=3D"0" width=3D"8" style=3D"padding: 0; font-fa= mily: Arial, sans-serif; font-size: 13px; line-height: 0px;"><img src=3D"ht= tps://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"0" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr><tr><td colspan=3D"= 3" valign=3D"top" height=3D"16" width=3D"4" style=3D"padding: 0; font-famil= y: Arial, sans-serif; font-size: 13px; line-height: 16px;"><img src=3D"http= s://iLinq.sheldoncollege.com/images/emails/spacer.gif" height=3D"16" width= =3D"0" border=3D"0" style=3D"display: block;"></td></tr></table></td></tr><= /table></td></tr></table></body></html> --_=_swift_1614670217_c748f5261860049c8d9488623e4f7deb_=_--
| ver. 1.4 |
Github
|
.
| PHP 7.4.33 | Generation time: 0 |
proxy
|
phpinfo
|
Settings