File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1605015006.M522955P16115.au6.voltdns.com,S=9893,W=10069:2,a
Back
Return-Path: <Chief_Human_Resources_Officer@cat.com> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id SIaBHt6Vql/zPgAATr7HEg (envelope-from <Chief_Human_Resources_Officer@cat.com>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Tue, 10 Nov 2020 23:30:06 +1000 Return-path: <Chief_Human_Resources_Officer@cat.com> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Tue, 10 Nov 2020 23:30:06 +1000 Received: from nsstlmta40p.bpe.bigpond.com ([203.38.21.40]:47214) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <Chief_Human_Resources_Officer@cat.com>) id 1kcTil-00047m-70 for ianhamilton@seafoodwarehouse.com.au; Tue, 10 Nov 2020 23:30:06 +1000 Received: from extmail.bigpond.com ([10.10.24.4]) by nsstlfep40p-svc.bpe.nexus.telstra.com.au with ESMTP id <20201110132922.YNNK9669.nsstlfep40p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Wed, 11 Nov 2020 00:29:22 +1100 Received-SPF: pass (extmail.bigpond.com: domain cat.com designates 12.2.142.8 as permitted sender) identity=mailfrom; receiver=extmail.bigpond.com; client-ip=12.2.142.8; envelope-from=Chief_Human_Resources_Officer@cat.com; helo=imail01.cis.cat.com; X-RG-Spam: Unknown X-RG-VS-CLASS: clean X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedujedruddujedghedvucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecunecujfgurhepggfhufgkvfffkfgtugesrgdtreertddtudenucfhrhhomhepvehhihgvfhcujfhumhgrnhcutfgvshhouhhrtggvshcuqfhffhhitggvrhcuoeevhhhivghfpgfjuhhmrghnpgftvghsohhurhgtvghspgfqfhhfihgtvghrsegtrghtrdgtohhmqeenucggtffrrghtthgvrhhnpedtueevudeltefgjeeivddvfeffffevkedtjedtleekteeigedtjeffieegieeiffenucfkphepuddvrddvrddugedvrdekpddufeejrddvfedtrddvtdeirdekjeenucevlhhushhtvghrufhiiigvpeduheenucfrrghrrghmpehhvghlohepihhmrghilhdtuddrtghishdrtggrthdrtghomhdpihhnvghtpeduvddrvddrudegvddrkedpmhgrihhlfhhrohhmpeeovehhihgvfhgpjfhumhgrnhgptfgvshhouhhrtggvshgpqfhffhhitggvrhestggrthdrtghomheqpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 0 X-RazorGate-Vade-Classification: clean Received: from imail01.cis.cat.com (12.2.142.8) by extmail.bigpond.com (5.8.420) id 5F72AA7C0BFAEEE5 for aussfdservices@bigpond.com; Wed, 11 Nov 2020 00:29:21 +1100 Received: from pps.filterd (armmailp23.cis.cat.com [127.0.0.1]) by armmailp23.cis.cat.com (8.16.0.42/8.16.0.42) with SMTP id 0AADOOSK017983 for <aussfdservices@bigpond.com>; Tue, 10 Nov 2020 07:29:16 -0600 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cat.com; h=mime-version : from : subject : to : date : message-id : content-type; s=0319cat; bh=m1suup7E7arj3zi2mzHlcfRzNMSNohnRO+mbRas31Ts=; b=TSz/UJul/owyjJXeQP3wa8xgawpiGhFceOOjRuLorEQ425lwfwIAmxZpTZsY9HZ4ikau 5r5P3K+Fa6n1RzhVdqbprdPg8dsX12aeHw87m9scudVxxqXYYa2/T+XK3N60uvYfl6Oy LO62tsmyijvflR95ZnP9eyPk6paEDByfVDm5URvH/KkGv4kWCGUWhy6etUlKrdlzA5A2 3D8QJKRk0b738sr2F5Q5hftFKKjSIRuQl3ge+Ik3Qt2oyd0Rj1RE/uYu3yXXSPcI2waz 62oDCki7dDQoZFVom0XSHrqpm+skLt1KireyHFiLkAM8TV7GJdewZ7lbc/lR+DXOXxKq oQ== Received: from arlmailp03.cis.cat.com (arwissvmailp05.mw.na.cat.com [137.230.206.87]) by armmailp23.cis.cat.com with ESMTP id 34nrpa2tb5-1 for <aussfdservices@bigpond.com>; Tue, 10 Nov 2020 07:29:16 -0600 Received: from Cat-clavin.cis.cat.com (notessmtp02.cis.cat.com [192.168.106.64]) by arlmailp03.cis.cat.com (8.15.1/8.15.1) with ESMTP id 0AADTFsl073810 for <aussfdservices@bigpond.com>; Tue, 10 Nov 2020 07:29:16 -0600 MIME-Version: 1.0 From: Chief Human Resources Officer <Chief_Human_Resources_Officer@cat.com> Importance: Sensitivity: To: aussfdservices@bigpond.com Date: Tue, 10 Nov 2020 07:29:16 -0600 X-MIMETrack: MIME-CD by Notes Client on Nick Chiras/0A/Caterpillar(Release 8.5.3FP6 SHF408|February 16, 2015) at 11/10/2020 07:29:16 AM, MIME-CD complete at 11/10/2020 07:29:16 AM, CD-MIME by Notes Client on Nick Chiras/0A/Caterpillar(Release 8.5.3FP6 SHF408|February 16, 2015) at 11/10/2020 07:29:16 AM, CD-MIME complete at 11/10/2020 07:29:16 AM, Itemize by Notes Client on Nick Chiras/0A/Caterpillar(Release 8.5.3FP6 SHF408|February 16, 2015) at 11/10/2020 07:29:16 AM, Serialize by Router on Cat-Clavin.cis.cat.com/Servers/Caterpillar(Release 9.0.1FP10 HF383|November 19, 2018) at 11/10/2020 07:29:16 AM, Serialize complete at 11/10/2020 07:29:16 AM Message-ID: <OFE1C3FCD1.168D91EC-ON8625861C.004A1771@notes.cat.com> X-CatConfidential: Green X-CaterpillarEncryptPostXMail: [REG MAIL] Content-type: multipart/alternative; Boundary="0__=09BB0C8FDFD991E18f9e8a93df938690918c09BB0C8FDFD991E1" Content-Disposition: inline X-Screened: arlmailp03.cis.cat.com X-CFilter-Loop: Reflected X-Proofpoint-Virus-Version: vendor=fsecure engine=2.50.10434:6.0.312,18.0.737 definitions=2020-11-10_05:2020-11-10,2020-11-10 signatures=0 X-Spam-Status: Yes, score=5.8 X-Spam-Score: 58 X-Spam-Bar: +++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Caterpillar recently became aware of facts that lead us to believe that our Caterpillar Global Directory has been accessed by an unauthorized third party. You are receiving this note because the infor [...] Content analysis details: (5.8 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: cat.com] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=chief_human_resources_officer%40cat.com;ip=203.38.21.40;r=au6.voltdns.com] 0.0 HTML_MESSAGE BODY: HTML included in message 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 2.0 PYZOR_CHECK Listed in Pyzor (https://pyzor.readthedocs.io/en/latest/) 0.0 FSL_BULK_SIG Bulk signature with no Unsubscribe X-Spam-Flag: YES Subject: ***SPAM*** Message from the Chief Human Resources Officer --0__=09BB0C8FDFD991E18f9e8a93df938690918c09BB0C8FDFD991E1 Content-transfer-encoding: quoted-printable Content-type: text/plain; charset=ISO-8859-1 Caterpillar recently became aware of facts that lead us to believe that= our Caterpillar Global Directory has been accessed by an unauthorized third= party. You are receiving this note because the information accessed cou= ld include items such as your name, work email address, phone numbers and other information that may be displayed in this internal Directory. At = this time, Caterpillar does not believe that any individual or company finan= cial information has been compromised. Caterpillar will continue to take steps to prevent harm, both to you an= d the company, including notifying and cooperating with the appropriate authorities and providing you with an update if our understanding of th= e situation changes. Thank you for your understanding. Cheryl Johnson Chief Human Resources Officer= --0__=09BB0C8FDFD991E18f9e8a93df938690918c09BB0C8FDFD991E1 Content-transfer-encoding: quoted-printable Content-type: text/html; charset=ISO-8859-1 Content-Disposition: inline <html><body bgcolor=3D"#FFFFFF"> <p><font size=3D"2" face=3D"Arial">Caterpillar recently became aware of= facts that lead us to believe that our Caterpillar Global Directory ha= s been accessed by an unauthorized third party. You are receiving this = note because the information accessed could include items such as your = name, work email address, phone numbers and other information that may = be displayed in this internal Directory. At this time, Caterpillar does= not believe that any individual or company financial information has b= een compromised.</font><font size=3D"3" face=3D"serif"> </font><br= > <font size=3D"2" face=3D"Arial">=A0</font><font size=3D"3" face=3D"seri= f"> </font><br> <font size=3D"2" face=3D"Arial">Caterpillar will continue to take steps= to prevent harm, both to you and the company, including notifying and = cooperating with the appropriate authorities and providing you with an = update if our understanding of the situation changes. </font><font size= =3D"3" face=3D"serif"> </font><br> <font size=3D"2" face=3D"Arial">=A0</font><font size=3D"3" face=3D"seri= f"> </font><br> <font size=3D"2" face=3D"Arial">Thank you for your understanding. </fon= t><font size=3D"3" face=3D"serif"> </font><br> <font size=3D"2" face=3D"Arial">=A0</font><font size=3D"3" face=3D"seri= f"> </font><br> <font size=3D"2" face=3D"Arial">Cheryl Johnson </font><font size=3D"3" = face=3D"serif"> </font><br> <font size=3D"2" face=3D"Arial">Chief Human Resources Officer</font><fo= nt size=3D"3" face=3D"serif"> </font></body></html>= --0__=09BB0C8FDFD991E18f9e8a93df938690918c09BB0C8FDFD991E1--
| ver. 1.4 |
Github
|
.
| PHP 7.4.33 | Generation time: 0 |
proxy
|
phpinfo
|
Settings