File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamiltonsnr/.spam/cur/1600076801.M555923P9057.au6.voltdns.com,S=37155,W=37904:2,
Back
Return-Path: <bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com> Delivered-To: ianhamiltonsnr+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id aFwGIQE8X19hIwAATr7HEg (envelope-from <bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com>) for <ianhamiltonsnr+spam@seafoodwarehouse.com.au>; Mon, 14 Sep 2020 19:46:41 +1000 Return-path: <bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com> Envelope-to: ianhamiltonsnr@seafoodwarehouse.com.au Delivery-date: Mon, 14 Sep 2020 19:46:41 +1000 Received: from nsstlmta21p.bpe.bigpond.com ([203.38.21.21]:58353) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com>) id 1kHl4I-0002KJ-Rj for ianhamiltonsnr@seafoodwarehouse.com.au; Mon, 14 Sep 2020 19:46:41 +1000 Received: from extmail.bigpond.com ([10.10.24.4]) by nsstlfep21p-svc.bpe.nexus.telstra.com.au with ESMTP id <20200914094558.LLKT11248.nsstlfep21p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <ianhamiltonsnr@bigpond.com>; Mon, 14 Sep 2020 19:45:58 +1000 Received-SPF: pass (extmail.bigpond.com: domain mail.wish.com designates 144.2.146.141 as permitted sender) identity=mailfrom; receiver=extmail.bigpond.com; client-ip=144.2.146.141; envelope-from=bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com; helo=mta-3-141.ml.wish.com; X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduiedrudeiiedgvddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpeggffhrshfjhffvuffktgfgsehhkeertddttdejnecuhfhrohhmpeghihhshhcuoehofhhfvghrshesfihishhhrdgtohhmqeenucggtffrrghtthgvrhhnpeeitddtueejffeutdektddvleekjeeihfehjeehiedtveejvedvueffvdfggeefueenucffohhmrghinhepfihishhhrdgtohhmpdhmrdhmvgdpfhgrtggvsghoohhkrdgtohhmpdhtfihithhtvghrrdgtohhmpdhinhhsthgrghhrrghmrdgtohhmnecukfhppedugeegrddvrddugeeirddugedunecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepmhhtrgdqfedqudeguddrmhhlrdifihhshhdrtghomhdpihhnvghtpedugeegrddvrddugeeirddugedupdhmrghilhhfrhhomhepoegsohhunhgtvghsodghuhgfggdtphhnhhefofgtledvphdoofgiudefufhsveeujgggghetsfgjuedukfdvsehmrghilhdrfihishhhrdgtohhmqedprhgtphhtthhopeeoihgrnhhhrghmihhlthhonhhsnhhrsegsihhgphhonhgurdgtohhmqecuqfftvefrvfeprhhftgekvddvnehirghnhhgrmhhilhhtohhnshhnrhessghighhpohhnugdrtghomh X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mta-3-141.ml.wish.com (144.2.146.141) by extmail.bigpond.com (5.8.420) id 5E83D99C2D2DF54B for ianhamiltonsnr@bigpond.com; Mon, 14 Sep 2020 19:45:58 +1000 DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=wish.com; s=mail; h=Content-Transfer-Encoding:Content-Type:Message-ID:Feedback-ID: Subject:To:From:List-Unsubscribe:Date:Mime-Version; bh=vXDlo4IG9+7+aa8qe0jSBcRHbHYQDALwgFuEOCMSNCI=; b=edtxil/ufIq/ZLc+dCmfZ2nWs0 lKw7TgTzevh9UIYOS9eizITT68Eendd7QazBR4fk6tMjB/6wGSP7HXMgctkVw8qXhcqGZytkTb9ST 1MRBpZDAKoHrKUGUkJkxSkYmCLM+xW+PcJ2fsReY/GPkzLLJO22iezqodQo/bAVIRu7k=; Mime-Version: 1.0 Date: Mon, 14 Sep 2020 02:45:56 -0700 Reply-To: replyto+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com Sender: bounces+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com List-Unsubscribe: <mailto:unsubscribe+WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2@mail.wish.com> X-Email-ID: WuUV0pnh3Mc92p+MX13SsCBYVgAQYB1I2 X-Campaign-ID: 5f5dd2b02058560010601d48 From: Wish <offers@wish.com> To: "Ian Hamilton" <ianhamiltonsnr@bigpond.com> Feedback-ID: 5ae515d299e1dcc73dda9f8c:5f5dd2b02058560010601d48:2:wishmailx Message-ID: <160007675571.652087.6236455003989983034@mail.wish.com> X-Mail-IP: 144.2.146.141 X-Email-Type: 2 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Spam-Status: Yes, score=5.8 X-Spam-Score: 58 X-Spam-Bar: +++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Laptop Liquidation? Get a faster laptop for $111 today 💻⌚ ... Hi Ian, Laptop Liquidation? Get a faster laptop for $111 today 💻⌚ ... WOMEN MEN ACCESSORIES HOME DECOR GADGETS Content analysis details: (5.8 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: fonts.googleapis.com] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=bounces%2Bwuuv0pnh3mc92p%2Bmx13sscbyvgaqyb1i2%40mail.wish.com;ip=203.38.21.21;r=au6.voltdns.com] 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 HTML_IMAGE_RATIO_02 BODY: HTML has a low ratio of text to image area 0.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts 1.1 KAM_REALLYHUGEIMGSRC RAW: Spam with image tags with ridiculously huge http urls -0.1 DKIM_VALID_EF Message has a valid DKIM or DK signature from envelope-from domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid 0.8 CPANEL_LOTS_OF_EMPTY_LINE RAW: Spam that has large block of empty lines 0.0 KAM_SHORT Use of a URL Shortener for very short URL X-Spam-Flag: YES Subject: ***SPAM*** =?UTF-8?q?Laptop_Liquidation=3F_Get_a_faster_laptop_for_$111_today_?= =?UTF-8?q?=F0=9F=92=BB=E2=8C=9A_...?= <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> <title> Laptop Liquidation? Get a faster laptop for $111 today 💻⌚ ... </title> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta name="viewport" content="width=device-width"/> <!-- Force outlook to not fallback to Times New Roman when web fonts fail to load --> <!--[if mso]> <style type="text/css"> .web-font-fix { font-family: helvetica !important; } </style> <![endif]--> <style> #outlook a { padding: 0; } .ExternalClass { width: 100%; } .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass font, .ExternalClass td, .ExternalClass div { line-height: 100%; } </style> <link href="https://fonts.googleapis.com/css?family=Lato" rel="stylesheet"> </head> <body style="width: 100% !important; min-width: 100%; -webkit-text-size-adjust: 100%; -ms-text-size-adjust: 100%;margin: 0;Margin: 0; padding: 0;-moz-box-sizing: border-box;-webkit-box-sizing: border-box;box-sizing: border-box;"> <img id="email-beacon" src="http://www.wish.com/email-beacon.png?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" height="1px" width="1px" /> <span style="color:#FFF; display:none !important; font-size:1px;"> Hi Ian, Laptop Liquidation? Get a faster laptop for $111 today 💻⌚ ... </span> <table style="background-color: #f5f5f5; width: 100%; border-collapse: collapse; border-spacing: 0"><tr><td align="center"> <table style="max-width:100%; width: 600px; background-color:transparent;border-collapse:collapse;border-spacing:0"> <tr> <td align="center" valign="top" style="background-color: white; width: 100%; min-width: 580px; padding: 0px;"> <a href="http://www.wish.com/?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_logo&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1"> <div style="background-color: #2FB7EC;"> <img src="http://main.cdn.wish.com/latest/img/email/remix/logos/wish.png?v=c771013" height="40" style="margin-top: 8px; margin-bottom: 8px; height: 40px;" /> </div> </a> <p style="text-align:center; margin: 10px 0 10px 0; margin: 14px 0 10px 0; "> <table style="width: 100%;"><tr align="middle"> <td style="text-align: center; max-width: 135px;"><a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_women&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="font-family: helvetica; word-wrap: normal; font-size:15px; color: #3c3c3c; font-weight: 100; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px; text-decoration: none; text-transform: uppercase;">WOMEN</a></td> <td style="text-align: center; max-width: 135px;"><a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_men&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="font-family: helvetica; word-wrap: normal; font-size:15px; color: #3c3c3c; font-weight: 100; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px; text-decoration: none; text-transform: uppercase;">MEN</a></td> <td style="text-align: center; max-width: 135px;"><a href="http://www.wish.com/?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_accessories&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1#tag=tag_53dc186421a86318bdc87f16" style="font-family: helvetica; word-wrap: normal; font-size:15px; color: #3c3c3c; font-weight: 100; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px; text-decoration: none; text-transform: uppercase;">ACCESSORIES</a></td> <td style="text-align: center; max-width: 135px;"><a href="http://www.wish.com/?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_home_decor&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1#tag=tag_53e9157121a8633c567eb0c2" style="font-family: helvetica; word-wrap: normal; font-size:15px; color: #3c3c3c; font-weight: 100; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px; text-decoration: none; text-transform: uppercase;">HOME DECOR</a></td> <td style="text-align: center; max-width: 135px;"><a href="http://www.wish.com/?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_gadgets&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1#tag=tag_53dc186421a86318bdc87f20" style="font-family: helvetica; word-wrap: normal; font-size:15px; color: #3c3c3c; font-weight: 100; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px; text-decoration: none; text-transform: uppercase;">GADGETS</a></td> </tr></table> </p> <p style="text-align:center; margin: 10px 0 10px 0; margin: 14px 0 10px 0; "> <table style="height: 60px; width: 100%; background:url('http://main.cdn.wish.com/latest/img/email/remix/referral_experiment/show-v3_info_strip.png?v=c3a1213') center/cover; background-image:url('http://main.cdn.wish.com/latest/img/email/remix/referral_experiment/show-v3_info_strip.png?v=c3a1213'); background-size:100%; background-size:cover; background-color: #fac62f;"> <tbody> <tr height="12"><td></td></tr> <tr align="middle"> <td style="text-align: center; max-width: 100%;"> <a href="http://www.wish.com/invite?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=header_referral_campaign&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style=" font-family: helvetica; word-wrap: normal; font-size: 16px; color: #000000; font-weight: 600; font-family: helvetica; letter-spacing:1.32px; margin: 0 0 8px 8px;"> Refer friends, earn up to $100. Share your code! </a> </td> </tr> <tr height="14"><td></td></tr> </tbody> </table> </p> <table border="0" cellpadding="0" cellspacing="0" width="100%"><tbody> <tr height="8"><td></td></tr> <tr><td style="text-align:center; padding-top: 32px; padding-bottom: 16px; font-family: serif; font-size: 28px; font-style: italic; color: #2FB7EC;" align="center"> Today's Trending Products </td></tr> <tr><td style="text-align:center;" align="center"> <table border="0" cellpadding="0" cellspacing="0" style="width:100%; margin:0 auto;" align="center"><tbody> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_0&rerank=5ef30aebfbd0411b7f2f3a49&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5ef30aebfbd0411b7f2f3a49&w=440&h=440&m=2" alt="Newest 10.1 Inch Ten..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$124</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $124 </span> </div> </td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_1&rerank=5dfd81edb2af860383979ab7&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5dfd81edb2af860383979ab7&w=440&h=440&m=2" alt="166° 1080P Two-Way V..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$53</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $797 </span> </div> </td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_2&rerank=5d8c9a9f8e936b59062fbe1c&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5d8c9a9f8e936b59062fbe1c&w=440&h=440&m=2" alt="Explosion-proof Ultr..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$3</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $3 </span> </div> </td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_3&rerank=5e7ab3e3fcc85c65c901d989&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5e7ab3e3fcc85c65c901d989&w=440&h=440&m=2" alt="5M/10M RGB LED Strip..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$25</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $220 </span> </div> </td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_4&rerank=5ddb6abd22902f3d4852eed6&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5ddb6abd22902f3d4852eed6&w=440&h=440&m=2" alt="NEW K07 Bluetooth Tr..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$12</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $12 </span> </div> </td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_5&rerank=5f232750cd040500d6f95aa5&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5f232750cd040500d6f95aa5&w=440&h=440&m=2" alt="S66 RC Drone with Ca..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$27</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $27 </span> </div> </td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_6&rerank=5cf75ed73ab15c38f77ee604&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5cf75ed73ab15c38f77ee604&w=440&h=440&m=2" alt="50W Multifunctional ..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$119</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $1,376 </span> </div> </td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=core_cids_7&rerank=5f30e541b1a15f0040e4a17e&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5f30e541b1a15f0040e4a17e&w=440&h=440&m=2" alt="Professional Undergr..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$95</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $3,162 </span> </div> </td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> </tbody></table> </td></tr> <tr><td style="text-align:center; padding-top: 32px; padding-bottom: 32px;" align="center"> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=shop_now&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style=" border-radius: 3px; color: #FFFFFF; display: inline-block; font-size: 18px; font-weight: bold; padding: 12px 16px; text-decoration: none; text-align: center; background-color: #2FB7EC; width: auto; font-size: 22px; padding: 12px 24px; ; text-transform: uppercase;"> Shop now </a> </td></tr> <tr><td style="text-align:center; padding-top: 16px; padding-bottom: 24px; font-family: serif; font-size: 28px; font-style: italic; color: #2FB7EC;" align="center"> Recommended For You </td></tr> <tr><td style="text-align:center;" align="center"> <table border="0" cellpadding="0" cellspacing="0" style="width:100%; margin:0 auto;" align="center"><tbody> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/c/5f3a556e3d878dc96c7797eb?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=recommended_cids_0&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5f3a556e3d878dc96c7797eb&w=440&h=440&m=2" alt="799/1pcs Aluminum Tr..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$18</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $25 </span> </div> </td> </tr> <tr> <td style="padding: 10px 0 14px;"></td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/c/5f34e69a12866a50f10186ee?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=recommended_cids_1&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5f34e69a12866a50f10186ee&w=440&h=440&m=2" alt="2Types Folding Wagon..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$25</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $206 </span> </div> </td> </tr> <tr> <td style="padding: 10px 0 14px;"></td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> <tr> <td style="width: 15px;" width="15"> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/c/5ec37b95f5a6c720fc81224e?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=recommended_cids_2&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5ec37b95f5a6c720fc81224e&w=440&h=440&m=2" alt="Heavy Duty Protectio..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$27</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $138 </span> </div> </td> </tr> <tr> <td style="padding: 10px 0 14px;"></td> </tr> </table> </td> <td> <table border="0" cellpadding="0" cellspacing="0" align="center" style="padding-top: 24px;"> <tr> <td> <a href="http://www.wish.com/c/5e97ff2706438d447bfc2861?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=recommended_cids_3&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none; color:#000000;"> <div style="display:inline-block; overflow:hidden; height: 220px; max-height:220px; width: 220px;"> <img src="https://contestimg.wish.com/api/image/fetch?contest_id=5e97ff2706438d447bfc2861&w=440&h=440&m=2" alt="2020 Newest Upgraded..." height="220" width="220" style="height: 220px; width: 220px"/> </div> </a> <div style="text-align: center; font-family: helvetica; font-weight: bold; font-size: 18px; padding-top: 12px;"> <span style="color: #2FB7EC;">$38</span> <span style="text-decoration: line-through; color: grey; font-weight: 500;"> $1,374 </span> </div> </td> </tr> <tr> <td style="padding: 10px 0 14px;"></td> </tr> </table> </td> <td style="width: 15px;" width="15"> </td> </tr> </tbody></table> </td></tr> <tr><td style="text-align:center; padding-top: 24px; padding-bottom: 48px;" align="center"> <a href="http://www.wish.com/home?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=shop_now_extra_recs&exzpl=ctp-1&filter=xparam-5f5ead60e40b6f0042881f8c&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style=" border-radius: 3px; color: #FFFFFF; display: inline-block; font-size: 18px; font-weight: bold; padding: 12px 16px; text-decoration: none; text-align: center; background-color: #2FB7EC; width: auto; font-size: 22px; padding: 12px 24px; ; text-transform: uppercase;"> Shop now </a> </td></tr> </tbody></table> <a href="http://www.wish.com/mobile-apps?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=download_apps&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style="text-decoration:none;"> <table style="background-color: #2FB7EC; width:600px;"> <tr align="center"> <td align="right" style="padding:10px 15px 10px 10px;width:275px;"><span class="web-font-fix" style="font-size:18px;text-decoration: none;text-transform: uppercase;font-weight: 100;color: white;vertical-align:middle;font-family: 'Lato', helvetica;">download our app</span> </td> <td> <img style="vertical-align:middle" src="http://main.cdn.wish.com/latest/img/email/remix/components/right_arrow_2x.png?v=a0d0f13" height="16"> </td> <td> <img style="vertical-align:middle" src="http://main.cdn.wish.com/latest/img/mobile_download_page/banner_google_equal.png?v=62cb513" width="100" height="30"> </td> <td align="left" style="width:150px;" width="150"> <img style="vertical-align:middle;" src="http://main.cdn.wish.com/latest/img/mobile_download_page/banner_apple_equal.png?v=61ed113" width="100" height="30"> </td> </tr> </table> </a> <p style="margin-top: 24px; margin-bottom: 20px;"> <a href="http://www.wish.com/invite?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=footer_referral_campaign&exzpl=ctp-1&utm_medium=email&utm_source=Wish+Discount&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1" style='color: #2fb7ec; font-size: 20px; font-weight: 700;'> Refer friends, earn up to $100. </a> </p> <p style="margin-top: 18px; margin-bottom: 14px;"> <a href="https://m.me/wish?ref=email_footer-uid_5ae515d299e1dcc73dda9f8c"><img src="http://main.cdn.wish.com/latest/img/email/remix/messenger.png?v=8e86513" style="margin: 0 7px 0 0; border-style: none;"/></a> <a href="https://www.facebook.com/wish/"><img src="http://main.cdn.wish.com/latest/img/email/remix/facebook.png?v=95b5313" style="margin: 0 7px 0 0; border-style: none;"/></a> <a href="https://twitter.com/wishshopping"><img src="http://main.cdn.wish.com/latest/img/email/remix/twitter.png?v=d06ee13" style="margin: 0 7px 0 0; border-style: none;"/></a> <a href="https://www.instagram.com/wish/"><img src="http://main.cdn.wish.com/latest/img/email/remix/instagram.png?v=a741613" style="margin: 0 7px 0 0; border-style: none;"/></a> </p> <p style="font-family: helvetica; font-size: 11px; font-weight: 100; color: #000000; text-align: center; margin: 0 45px;"> Wish is a marketplace that lets you discover items from thousands of merchants around the world. Check out these merchants' deals! (Reference prices and discounts or savings provided by merchants) </p> <p style="font-family: helvetica; font-size: 11px; font-weight: 100; color: #000000; text-align: center;"> You are receiving this email because you subscribed at <a href="http://wish.com" style="color: #000000; text-decoration: underline;">wish.com</a>. <br /> To opt-out of receiving future emails, you may do so <a href=http://www.wish.com/unsubscribe-email?utm_campaign=5f5dd2b02058560010601d48&uuid=d9e3720f4d144f42bda9770513bc5584&cmpgnid=5f5dd2b02058560010601d48&ee=v1_2AZFX9MzU7rbAXBai6UuirzdzLLucjcb9MWkfwbhhNS6juKHsTZWoyw2iHzx9r5crnyuFe925EjWzgoehY43gtbekTo&email_section=unsubscribe&exzpl=ctp-1&d=v1_3waQc8S7CMj3Wz3vCAPYEt7Xhb5hKSmdGycPpSoByRnPUBkP8Bfyo9v7PdNts7Zi8RLG3iSgQDaLcgjsbvSDeTiE&no_deep_link=True&utm_medium=email&utm_source=Wish+Discount&action=unsubscribe&recvuid=5ae515d299e1dcc73dda9f8c&iscommerc=1 style='color: #000000; text-decoration: underline;'>here</a>. </p> <p style="font-family: helvetica; font-size: 11px; font-weight: 100; color: #000000; text-align: center;"> 1 Sansome St., 40th Floor, San Francisco, CA 94104 - USA </p> <p style="font-family: helvetica; font-size: 11px; font-weight: 100; color: #000000; text-align: center; padding-bottom: 24px;"> This email was sent from a notification-only address that cannot accept incoming emails. <br /> Please do not reply to this message. If you have any questions or concerns, please contact us at support@wish.com </p> </td> </tr> <tr><td style="height: 12px;background-color: white;"></td></tr> </table> </td></tr></table> </body> </html>
| ver. 1.4 |
Github
|
.
| PHP 7.4.33 | Generation time: 0 |
proxy
|
phpinfo
|
Settings