File manager

File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1595808759.M271145P1555.au6.voltdns.com,S=51576,W=52245:2,a

Back
Return-Path: <bounce-333_HTML-107631732-4510037-6010675-64@bounce.e.bcf.com.au> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id WBYJEPcbHl8TBgAATr7HEg (envelope-from <bounce-333_HTML-107631732-4510037-6010675-64@bounce.e.bcf.com.au>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Mon, 27 Jul 2020 10:12:39 +1000 Return-path: <bounce-333_HTML-107631732-4510037-6010675-64@bounce.e.bcf.com.au> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Mon, 27 Jul 2020 10:12:39 +1000 Received: from nsstlmta26p.bpe.bigpond.com ([203.38.21.26]:35896) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <bounce-333_HTML-107631732-4510037-6010675-64@bounce.e.bcf.com.au>) id 1jzqku-0000TC-F8 for ianhamilton@seafoodwarehouse.com.au; Mon, 27 Jul 2020 10:12:39 +1000 Received: from extmail.bigpond.com ([10.10.24.4]) by nsstlfep26p-svc.bpe.nexus.telstra.com.au with ESMTP id <20200727001155.EWWQ3040.nsstlfep26p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Mon, 27 Jul 2020 10:11:55 +1000 X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduiedrheekgdefvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfupfevtfgpvffgnffuvfftteenuceurghilhhouhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhephffvufffjfggjefktgesrgdtreertddtjeenucfhrhhomhepfdevlhhusgcuueevhfdfuceotghluhgssggtfhesvgdrsggtfhdrtghomhdrrghuqeenucggtffrrghtthgvrhhnpeejieekffeifeeuieeiueetjedtfedtffeftdeukefhheduffeukedvjedtgefgvdenucffohhmrghinhepsggtfhdrtghomhdrrghunecukfhppeduleelrdduvddvrdduvddtrdektdenucevlhhushhtvghrufhiiigvpedufeelieenucfrrghrrghmpehhvghlohepmhhtrgdrvgdrghholhgutghrohhsshdrtghomhdrrghupdhinhgvthepudelledruddvvddruddvtddrkedtpdhmrghilhhfrhhomhepoegsohhunhgtvgdqfeeffegpjffvoffnqddutdejieefudejfedvqdeghedutddtfeejqdeitddutdeijeehqdeigeessghouhhntggvrdgvrdgstghfrdgtohhmrdgruhequceuqfffjgepkeeukffvoffkoffgpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mta.e.goldcross.com.au (199.122.120.80) by extmail.bigpond.com (5.8.420) id 5EF622DF077263B6 for aussfdservices@bigpond.com; Mon, 27 Jul 2020 10:11:55 +1000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=200608; d=e.bcf.com.au; h=From:To:Subject:Date:List-Unsubscribe:MIME-Version:List-ID:X-CSA-Complaints: Message-ID:Content-Type; i=clubbcf@e.bcf.com.au; bh=oizsEJOqXlA+elEo5FU8rfVh8mldtW4JCMM2JwcyV9A=; b=rprPq1R1/30+Bb5iGjA4TBHrG/g0kbBdE5raG8NUqX2Ks3RFGIjrTcmam//G53N+d0Cq3FgmZDNE gtOSORGePr9W1SDb9y6IzbrhWL+GHZHpI119oQBn12LdOupRqsROLRbWO/4+RbIDuVoq15UvgCdA EQku/R8ex07kf4Upmw8= Received: by mta.e.goldcross.com.au id h3odsm2fmd4v for <aussfdservices@bigpond.com>; Mon, 27 Jul 2020 00:04:02 +0000 (envelope-from <bounce-333_HTML-107631732-4510037-6010675-64@bounce.e.bcf.com.au>) From: "Club BCF" <clubbcf@e.bcf.com.au> To: <aussfdservices@bigpond.com> Date: Sun, 26 Jul 2020 18:03:57 -0600 List-Unsubscribe: <mailto:leave-fd521773760b5c392848-fe3115707262077c721772-fe9b10757464047e72-fe9612707464027a70-ff951274@leave.e.bcf.com.au> MIME-Version: 1.0 List-ID: <7004389.xt.local> X-CSA-Complaints: whitelist-complaints@eco.de X-SFMC-Stack: 6 x-job: 6010675_4510037 Message-ID: <00747d94-d1e3-4712-a79c-d0fa9fd174b0@ind1s06mta1476.xt.local> Content-Type: multipart/alternative; boundary="W5FFokFq9oE2=_?:" X-Spam-Status: Yes, score=5.4 X-Spam-Score: 54 X-Spam-Bar: +++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: http://view.e.bcf.com.au/?qs=4c50524acbcf3363167a36699b0e8477764f6dad4ec7bdc06bb8197e300382f91eb8e1491999eb90f981606b6d19369294887903094329b9c88f060c6df5076e8eabc60dadf5f7417ac75fc69238fc43 View onlin [...] Content analysis details: (5.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: bcf.com.au] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=bounce-333_html-107631732-4510037-6010675-64%40bounce.e.bcf.com.au;ip=203.38.21.26;r=au6.voltdns.com] 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 T_KAM_HTML_FONT_INVALID BODY: Test for Invalidly Named or Formatted Colors in HTML -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [203.38.21.26 listed in list.dnswl.org] 2.0 PYZOR_CHECK Listed in Pyzor (https://pyzor.readthedocs.io/en/latest/) 0.2 KAM_LOTSOFHASH Emails with lots of hash-like gibberish X-Spam-Flag: YES Subject: *SPAM* Ian, Slumberest - NEW to BCF This is a multi-part message in MIME format. --W5FFokFq9oE2=_?: Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 8bit http://view.e.bcf.com.au/?qs=4c50524acbcf3363167a36699b0e8477764f6dad4ec7bdc06bb8197e300382f91eb8e1491999eb90f981606b6d19369294887903094329b9c88f060c6df5076e8eabc60dadf5f7417ac75fc69238fc43 View online Contact free shipping on orders over $99 – Metro and Regional* http://click.e.bcf.com.au/?qs=f0e5a653e0520e83bbfe67f0386de9a81078d4bf992cf7c73188719b781145e0387c6eb8164a35c101c573bf5d2e19a5d6343474848f6070 http://click.e.bcf.com.au/?qs=f0e5a653e0520e832232429f6726f3e4899f0cb8996f91ab607476036a60fb35ed6e3f58646d9b3bcbdbee20608b9c7af39b8e6a452fd03a http://click.e.bcf.com.au/?qs=f0e5a653e0520e838ade65637e6da92c36a9530f7af02d18bc98147888d05ce131879d85a88eca5bcdececf7f4834ff9a4b74b3a0269ce6c http://click.e.bcf.com.au/?qs=f0e5a653e0520e832eec1814f0ce9cf28fe2e99f4b9c59e992b9a3fb58b660a0237175b5294d6d11d4a15b9672a0bec0845e7b3e059573ca http://click.e.bcf.com.au/?qs=f0e5a653e0520e83506da476f885ca459e2abd2825c87c403f98dbd23bd755ea96602bc1521613b23841614f88ad8914c5c85ad2e0c5ec0f Boating http://click.e.bcf.com.au/?qs=f0e5a653e0520e831afddea4c91b8dfd1ba044c76a85ad48dfcf85fef776e4ba1e90ce5e13596f7513601283b80979dfaafe94a51b50cb27 Camping http://click.e.bcf.com.au/?qs=f0e5a653e0520e83a8d636624af54f991cbb7946af440f0dc0ebc9e1ec21480af6215bad8f81fe4edf5aa6b2f2b17aa3d28a0647552d084b Fishing http://click.e.bcf.com.au/?qs=8fa9fa49de0483c93aa8166f94e5127194eda7d26c4147b5ef89e93f154fbddc53963aafa8f83ffc71f9c75baa69f6567bb750a021153de1 Sale http://click.e.bcf.com.au/?qs=8fa9fa49de0483c94952d1b7f987dd42f37b530d8448fa7a031d19181e41ccc2d80a31314a17727bb4d44705065d27fe15d8cb86fca6574d http://click.e.bcf.com.au/?qs=8fa9fa49de0483c9c884c96e9dbccdbba062adbb03b47fc7bf5ccea6226fd7af692f0ca49c6c0066c8411d0de184bd8c3d590f38721d70d5 Free shipping excludes bulky items. Available for delivery to Metro and Regional areas. Free returns for online orders under 10kg. For full T&Cs visit our website. http://click.e.bcf.com.au/?qs=8fa9fa49de0483c902c6c39baa270f047c63d23586761b9e17d03300ffcbc8b7f5fd6520be9e58756bc8350983990a9d1438f7e27446981f http://click.e.bcf.com.au/?qs=8fa9fa49de0483c94c0c856d16de6f97564229d0efebe968f66a393eca2f3ed59c3e388473cce0714b6a96ead5bca3f261fcc626f39b08a3 http://click.e.bcf.com.au/?qs=8fa9fa49de0483c94e22cee18e02f2de92b782a9fe9aee0ba7ea680470e84818aaa0d27229c46d9c64e1101297e3c7cfc7fa5600e67c14cc http://click.e.bcf.com.au/?qs=8fa9fa49de0483c9c9cde3fb811d12415a3ed39a03ba958cd34e46a1209e96ddbc0207f985ce026c2c59908cfdadda9e978814126090d183 Follow Us http://click.e.bcf.com.au/?qs=8fa9fa49de0483c98618334d723488eaa9fc1b9956e1938c1fb635487fb68b17787b9a117c80c36601db7677f08ba29fa136767143faee52 http://click.e.bcf.com.au/?qs=8fa9fa49de0483c927ecabedb90b685e4a5c329485ea44d9efdd9de9bc80126123712179d8ada775e5aec53830ef02343d40281c98d9f448 http://click.e.bcf.com.au/?qs=8fa9fa49de0483c94ebd7bff7ad09257ecefa65735f41dc2825b637df4f8862b1e3bcdd66b947746a8f1a48a57bad19895d2bffd86540871 http://click.e.bcf.com.au/?qs=47088b881064631fa25a1a7137072b65d06cf63938635844805c09966b816844256949c2c8e9f17fcf085834c2141a5fe8bdaefc9de26f83 Update Details http://click.e.bcf.com.au/?qs=47088b881064631f3c2a2639f03c240f293152ae0fbf57cbbeb73f50d3b4119d6f178d00efd94181cb561becae4e2093fd75c28b69ed6f5e Privacy Policy http://click.e.bcf.com.au/unsub_center.aspx?qs=cf5b34df9a22b6249a84c58e0e6e3a671b7a83589a83a3b388a30a6119086794fa44851a8252e6af66c7e9c4965dc4f105f3a14621e442241b594c3d60abf53b4a2930f54ad7f302 Unsubscribe http://click.e.bcf.com.au/?qs=47088b881064631f6cdfe8883a7c2b1de47cd97874eb5639d22daa934f84ccfdca05b8893b15998e01abd852a03b23b17ac787080b6b6282 Contact Us Add mailto:clubbcf@bcf.com.au clubbcf@e.bcf.com.au to you contacts to receive the latest and greatest offers. This email was sent to mailto:aussfdservices@bigpond.com aussfdservices@bigpond.com and was sent by Club BCF, BCF Australia, 6 Coulthards Ave, STRATHPINE, QLD, 4500, Australia tel:1300 880 764 1300 880 764 (c) 2020 BCF Australia http://click.e.bcf.com.au/?qs=47088b881064631f86f593ee29ffdfc9f8b7da9b1a3235b284388a3d6ff483da4faaf782117d485256dcff68f534edc3d08d0043f2bb461c About Us http://click.e.bcf.com.au/?qs=47088b881064631f9c2dd2fd16ad1f2192f64749f12ff74629e6d91e1c3cef4beb458e202a12bd25f7d93d04ede0c8c1be531a514df14c0c Help Desk http://click.e.bcf.com.au/?qs=47088b881064631f75b0b3162ac41876e1258513575428331690e602671b8d521daaca9d63621912b14bae2f259589cdddf9dc1ece9a81db Site Map --W5FFokFq9oE2=_?: Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: 8bit <!DOCTYPE html> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta charset="utf-8"> <!-- utf-8 works for most cases --> <meta name="viewport" content="width=device-width"> <!-- Forcing initial-scale shouldn't be necessary --> <meta http-equiv="X-UA-Compatible" content="IE=edge"> <!-- Use the latest (edge) version of IE rendering engine --> <meta name="x-apple-disable-message-reformatting"> <!-- Disable auto-scale in iOS 10 Mail entirely --> <title></title> <!-- The title tag shows in email notifications, like Android 4.4. --> <!-- Web Font / @font-face : BEGIN --> <!-- NOTE: If web fonts are not required, lines 10 - 27 can be safely removed. --> <!-- Desktop Outlook chokes on web font references and defaults to Times New Roman, so we force a safe fallback font. --> <!--[if mso]> <style> { font-family: sans-serif !important; } </style> <![endif]--> <!-- All other clients get the webfont reference; some will render the font and others will silently fail to the fallbacks. More on that here: http://stylecampaign.com/blog/2015/02/webfont-support-in-email/ --> <!--[if !mso]><!--> <link href="https://fonts.googleapis.com/css?family=Montserrat:100,200,300,400,500,600,700,800,900" rel="stylesheet"> <link href="https://fonts.googleapis.com/css?family=Open+Sans+Condensed:300,700" rel="stylesheet"> <!--<![endif]--> <!-- Web Font / @font-face : END --> <!-- CSS Reset --> <style> /* What it does: Remove spaces around the email design added by some email clients. / / Beware: It can remove the padding / margin and add a background color to the compose a reply window. / html, body { margin: 0 auto !important; padding: 0 !important; height: 100% !important; width: 100% !important; } / What it does: Stops email clients resizing small text. / { -ms-text-size-adjust: 100%; } /* What it does: Centers email on Android 4.4 / div[style="margin: 16px 0"] { margin:0 !important; } /* What it does: Stops Outlook from adding extra spacing to tables. / table, td { mso-table-lspace: 0pt !important; mso-table-rspace: 0pt !important; } / What it does: Fixes webkit padding issue. Fix for Yahoo mail table alignment bug. Applies table-layout to the first 2 tables then removes for anything nested deeper. / table { border-spacing: 0 !important; border-collapse: collapse !important; table-layout: fixed !important; margin: 0 auto !important; } table table table { table-layout: auto; } / What it does: Uses a better rendering method when resizing images in IE. / img { -ms-interpolation-mode:bicubic; } / What it does: A work-around for iOS meddling in triggered links. / [x-apple-data-detectors] { color: inherit !important; text-decoration: none !important; } /* What it does: A work-around for email clients meddling in triggered links. / [x-apple-data-detectors], /* iOS / .x-gmail-data-detectors, / Gmail / .x-gmail-data-detectors , .aBn, .dontLink a { border-bottom: 0 !important; cursor: default !important; color: inherit !important; text-decoration: none !important; font-size: inherit !important; font-family: inherit !important; font-weight: inherit !important; line-height: inherit !important; } /* What it does: Prevents Gmail from displaying an download button on large, non-linked images. / .a6S { display: none !important; opacity: 0.01 !important; } / If the above doesn't work, add a .g-img class to any image in question. / img.g-img + div { display:none !important; } / What it does: Prevents underlining the button text in Windows 10 / .button-link { text-decoration: none !important; } .hide-input{ display: none!important; } / What it does: Removes right gutter in Gmail iOS app: https://github.com/TedGoas/Cerberus/issues/89 / / Create one of these media queries for each additional viewport size you'd like to fix / / iPhone 4, 4S, 5, 5S, 5C, and 5SE / @media only screen and (min-device-width: 320px) and (max-device-width: 374px) { u ~ div .email-container { min-width: 320px !important; } } / iPhone 6, 6S, 7, 8, and X / @media only screen and (min-device-width: 375px) and (max-device-width: 413px) { u ~ div .email-container { min-width: 375px !important; } } / iPhone 6+, 7+, and 8+ / @media only screen and (min-device-width: 414px) { u ~ div .email-container { min-width: 414px !important; } } </style> <!-- Progressive Enhancements --> <style> body[data-outlook-cycle] .outlook-hide { display:none !important; } .mobileOnly { max-height: 0px; min-height: 0px; /Gmail seems to add min-height by itself/ font-size: 0; display: none; max-width: 0px; overflow: hidden; } / Media Queries / @media screen and (max-width: 480px) { u + .body .gmail{ display:none !important; } / What it does: Forces elements to resize to the full width of their container. Useful for resizing images beyond their max-width. / .fluid, .fluid img { width: 100% !important; max-width: 100% !important; height: auto !important; margin-left: auto !important; margin-right: auto !important; } / What it does: Forces table cells into full-width rows. / .stack-column, .stack-column-center { display: block !important; width: 100% !important; max-width: 100% !important; direction: ltr !important; } / And center justify these ones. / .stack-column-center { text-align: center !important; } / What it does: Generic utility class for centering. Useful for images, buttons, and nested tables. / .center-on-narrow { text-align: center !important; display: block !important; margin-left: auto !important; margin-right: auto !important; float: none !important; } table.center-on-narrow { display: inline-block !important; } / What it does: Adjust typography on small screens to improve readability / p { font-size: 15px !important; } .mobile-hidden { display: none !important; } .mobileOnly { max-height: none !important; min-height: none !important; font-size: 15px !important; line-height:20px !important; display: block !important; max-width: none !important; overflow: visible !important; } .show_mobile { display: inline-block!important; max-height: none!important; overflow: visible!important; } .icon-m { height: 20px !important; width:auto !important; padding: 0 5px !important; float: right !important; } .icon-align { text-align: right !important; } .menu_wrapper { width: 100% !important; } .menu_wrapper2 { background: #eeeeee; width: 100% !important; /display: block !important;/ display: block; color: #000000 !important; text-align: center !important; padding: 15px 0 !important; line-height: 100% !important; border-top: 1px solid #ffffff; } .menu_sale { background: #eeeeee; width: 100% !important; /display: block !important;/ display: block; text-align: center !important; padding: 15px 0 !important; line-height: 100% !important; border-top: 1px solid #ffffff; } .menu_hide { display: none !important; } .menu_hide_desktop { display: table !important; float: none !important; width: 100% !important; overflow: visible !important; height: auto !important; } #menu_drop:checked + .inn { margin-top: 0%; } div .link { position: relative !important; width: 100% !important; padding: 0px !important; right: 0px !important; top: 0px !important; overflow: hidden !important; transition: all 1.0s ease-in-out 0s; -webkit-transition: all 1.0s ease-in-out 0s; -o-transition: all 1.0s ease-in-out 0s; height: auto !important; } div .inn { transition: all 1.0s ease-in-out 0s; -webkit-transition: all 1.0s ease-in-out 0s; -o-transition: all 1.0s ease-in-out 0s; margin-top: -155%; padding: 0 !important; overflow: hidden !important; } } @media only screen and (max-device-width : 320px) { .footer-links a, .footer-links span { font-size: 11px !important; line-height: 140% !important; } } </style> <!-- Progressive Enhancements : END --> <!--[if mso]> <style type="text/css"> ul, li {margin-left: 25px !important;} </style> <![endif]--> <!--[if (mso)\|(mso 16)]> <style type="text/css"> a {text-decoration: none;} </style> <![endif]--> <!-- What it does: Makes background images in 72ppi Outlook render at correct size. --> <!--[if gte mso 9]> <xml> <o:OfficeDocumentSettings> <o:AllowPNG/> <o:PixelsPerInch>96</o:PixelsPerInch> </o:OfficeDocumentSettings> </xml> <![endif]--> </head> <body class="body" width="100%" bgcolor="#ffffff" style="margin: 0; mso-line-height-rule: exactly;"><style type="text/css"> div.preheader { display: none !important; } </style> <div class="preheader" style="font-size: 1px; display: none !important;">Check it out</div> <center style="width: 100%; background: #ffffff; text-align: left;"> <div style="max-width: 660px; margin: 0 auto;" class="email-container"> <!--[if mso \| IE]> <table role="presentation" border="0" cellpadding="0" cellspacing="0" width="100%" align="center" style="width:100%;" bgcolor="#ffffff"> <tr> <td> <table role="presentation" border="0" cellpadding="0" cellspacing="0" width="660" align="center" style="width:660px;"> <tr> <td> <![endif]--> <table role="presentation" cellspacing="0" cellpadding="0" border="0" align="center" width="100%" style="max-width: 660px;"> <tr> <td align="center"> <!-- Email Content : BEGIN --> <table role="presentation" cellspacing="0" cellpadding="0" border="0" width="100%"> <tr> <td align="center" style="font-size: 0px; line-height: 0;">  <!----><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px 20px; " class="stylingblock-content-wrapper camarker-inner"><!-- Email Disclaimer : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="font-family: 'Montserrat', Helvetica, Arial, sans-serif; font-size: 11px; line-height: 15px; font-weight: 400; color: #cccccc; text-align: right;"> <a data-linkto="other" href="http://view.e.bcf.com.au/?qs=4c50524acbcf3363167a36699b0e8477764f6dad4ec7bdc06bb8197e300382f91eb8e1491999eb90f981606b6d19369294887903094329b9c88f060c6df5076eb60fc3769cf207d0e3ecc97d6c184579" style="color:#000000;text-decoration:none; white-space: nowrap;" title="View online">View online</a></td></tr></table><!-- Email Disclaimer : END --></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 10px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #005593; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><!-- Email Header : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 10px 0; text-align: center; font-family: 'Montserrat', Helvetica, Arial, sans-serif; font-size: 13px; line-height: 18px; color: #FFFFFF; font-weight: normal;"> Contact free shipping on orders over $99 – Metro and Regional</td></tr><tr> <td align="center" style="padding: 0 20px;" valign="middle"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" width="25%"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <!--[if !mso]><!-- --> <tr> <td height="0"> <div class="menu_hide_desktop" style="display:none;width:0;overflow:hidden;max-height:0!important"> <table align="center" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" height="40" valign="middle"> <label class="outlook-hide" for="menu_drop"><img border="0" height="30" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/6a170efe-c0ee-4c86-ab76-f2131a4bce19.png" style="display:block;cursor:pointer;" width="30"></label></td></tr></table></div></td></tr><!--<![endif]--></table><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" class="mobile-hidden"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=ea80e625c93213538acf4560786749d32865c3096842c2eab87ed8b9bac9b314614d9997abe3044daa5d860f3dc6d7e968eebe799d55a2a7" style="color: #ffffff; text-decoration: none;" title="Local Store"><img alt="Local Store" height="40" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/74f500bf-c362-430d-a9ea-297e17b1e600.png" style="height: 40px; width: 28px; padding: 0px; text-align: center;" width="28"></a></td></tr></table></td><td align="center" style="padding: 10px 0 20px 0;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=ea80e625c9321353f7b40a205254e4ee8a2e2bd63f4f3ec209f9524ad2f0cbdcc9aca66fc5fec54ddfd186aaa7966785fc0c360e595f50fa" style="color: #ffffff; text-decoration: none;" title="BCF"><img alt="BCF" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/c59a1430-fdb2-4642-9ce2-907bd1c1e08a.png" style="width: 100%; max-width: 125px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; font-size: 15px; line-height: 140%; color: #FFFFFF; margin: auto; padding: 0px; text-align: center;" width="125"></a></td><td align="center" class="icon-align" width="25%"> <!--[if !mso]><!--><div class="show_mobile" style="display:none;max-height:0px;overflow:hidden;"> <a href="http://click.e.bcf.com.au/?qs=ea80e625c9321353d8153b146d81b52f134e717060c41e993e3103b499407b187043d69ff4dfea138bc44c61364c54be593de7066b76f8e2" style="color: #ffffff; text-decoration: none;"><img border="0" class="icon-m" height="40" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/74f500bf-c362-430d-a9ea-297e17b1e600.png"></a></div><!--<![endif]--><a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b949d54fb2d0892a9958504f7cf68540b11c2153313f183ae21773db5a1efd158ec2af9c31069659e16846d4e6ac8e368e5" style="color: #ffffff; text-decoration: none;" title="Member login"><img alt="Member login" border="0" class="icon-m" height="40" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/3c771ced-c9a1-4155-bba8-018b7ad5503a.png" style="height: 40px; width: 39px; padding: 0px; text-align: center;" width="39"></a></td></tr></table></td></tr></table><!-- Email Header : END --></td></tr></table></td></tr> </table> <!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 10px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #005593; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><!-- Navigation : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" class="outlook-hide"> <!--[if !mso]><!-- --><div class="menu_relative"> <div class="link"> <input class="hide-input" id="menu_drop" style="display:none !important; max-height:0px; overflow:hidden;" type="checkbox"><div class="inn" style="margin-left:0px; margin-right:0px; z-index:50;"> <!--<![endif]--><!--[if gte mso 9]> <table width="100%" border="0" cellspacing="0" cellpadding="0" align="center" class="menu_wrapper"> <tr> <td height="40" valign="middle" align="center" width="25%"> <![endif]--><a class="menu_wrapper2" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b948ba8f3db0e5bbbd1d60b79c9430d571465c72dd1c8c3d2cb73b0a5d2a4a4b2417b92adae8577af9f57f70ca2c2319af4" style="font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700;text-decoration:none;text-transform:uppercase;color:#ffffff;line-height:100%;padding: 15px 0; width:25%; float:left; display:inline-block; text-align: center;" target="_blank">Boating</a> <!--[if gte mso 9]> </td> <td height="40" valign="middle" align="center" width="25%"> <![endif]--> <a class="menu_wrapper2" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b948466744363f0a2521bd203a7d035dec8bcaa4cab38493574de939b8d5d272f201cde160c7636d550f49145da9456a94a" style="font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700;text-decoration:none;text-transform:uppercase;color:#ffffff;line-height:100%;padding: 15px 0; width:25%; float:left; display:inline-block; text-align: center;" target="_blank">Camping</a> <!--[if gte mso 9]> </td> <td height="40" valign="middle" align="center" width="25%"> <![endif]--> <a class="menu_wrapper2" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b94b0d546052376d99ba55a42446ce8339b2188cb1371be092365ebf3c8744fce96b73401d2d05f79d63f9ed19751cbefe4" style="font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700;text-decoration:none;text-transform:uppercase;color:#ffffff;line-height:100%;padding: 15px 0; width:25%; float:left; display:inline-block; text-align: center;" target="_blank">Fishing</a> <!--[if gte mso 9]> </td> <td height="40" valign="middle" align="center" bgcolor="#e65921"> <![endif]--> <a class="menu_sale" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b94a8f64357e26157b20b40c091a8608783938c79aa003225c53134c1555cab8bb88a7058bf86f6c23e06163855ea28701f" style="background: #e65921; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700;text-decoration:none;text-transform:uppercase;color:#ffffff;line-height:100%;padding: 15px 0; width:25%; float:left; display:inline-block; text-align: center;" target="_blank">Sale</a> <!--[if gte mso 9]> </td> </tr> </table> <![endif]--> <!--[if !mso]><!--></div></div></div><!--<![endif]--></td></tr></table><!-- Navigation : END --></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 10px; "> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b94487a17db05500d1c8acc741839492bb37f4505df24748a5b41e3508d23fba6c5bab8063a837d70d2084903d1948ca3d7" title="New to BCF - Slumberest" data-linkto="https://"> <img data-assetid="136146" src="http://image.e.bcf.com.au/lib/fe9612707464027a70/m/7/e7693500-dbcb-4914-b23c-8299986e9da4.jpg" alt="New to BCF - Slumberest" width="640" style="display: block; padding: 0px; text-align: center; height: auto; width: 100%; border: 0px;"></a></td></tr></table></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 10px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"> <a href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b943d1080de57f405dc1d225952ef2a38c19f59ce5ccdd1387969f792fbdf16da099db1f9d158a6beca2c94f294635dcaa5" title="Slumberest Cloud 9" data-linkto="https://"> <img data-assetid="136147" src="http://image.e.bcf.com.au/lib/fe9612707464027a70/m/7/d2601244-4ad3-47b9-b3e9-d6bf827193f4.jpg" alt="Slumberest Cloud 9" width="640" style="display: block; padding: 0px; text-align: center; height: auto; width: 100%; border: 0px;"></a></td></tr></table></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><img src="https://ad.doubleclick.net/ddm/trackimp/N910500.3027089SALESFORCE/B22461890.242995092;dc_trk_aid=439372608;dc_trk_cid=113762115;ord=[timestamp];dc_lat=;dc_rdid=;tag_for_child_directed_treatment=;tfua=?" border="0" height="1" width="1" alt="Advertisement"></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr> <td class="stylingblock-content-margin-cell" style="padding: 10px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; border-top: 1px solid #AEAEAE; border-right: 0px; border-bottom: 0px; border-left: 0px; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 20px; " class="stylingblock-content-wrapper camarker-inner"><table align="center" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="img-max" width="100%"> <tr> <td align="center" bgcolor="#ffffff" style="font-family: Montserrat,sans-serif; font-size: 14px; padding: 15px 12px; color: #ffffff !important; line-height: 1.75 !important;" valign="top" width="100%"> <font color="#000000">*Free shipping excludes bulky items. Available for delivery to Metro and Regional areas.<br> Free returns for online orders under 10kg.<br> For full T&Cs visit our website.</font></td></tr></table></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><!-- O Footer Icons — 2 x 2 Mobile : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" class="nopad" style="padding: 0 8px;"> <!--[if mso \| IE]> <table role="presentation" border="0" cellpadding="0" cellspacing="0" width="644" align="center" style="width:644px;"> <tr> <td> <![endif]--><table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" style="max-width: 644px;" width="100%"> <tr> <td align="center" style="text-align:center; font-size:0;"> <!--[if (gte mso 9)\|(IE)]> <table role="presentation" cellspacing="0" cellpadding="0" border="0" align="center" width="100%"> <tr> <td width="322" valign="top" style="padding:0;"> <![endif]--><div class="stack-column" style="width:100%;min-width:280px;max-width:50%;display:inline-block;vertical-align:top;"> <table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 2px;"> <table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" class="fluid" style="border-right: solid 4px #ffffff;"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b94936d9ad732ab3fd2fe544f17bce15adc96b048bd2875c3e10fc6fbf5625f905f2309dd7371c110e672abea54e3a96da8" target="_blank" title="Click and Collect"><img alt="Click & Collect" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/92e67a6b-5c89-4340-b972-e0728dcd73cf.png" style="width: 100%; max-width: 157px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #333333; display: block; padding: 0px; text-align: center;" width="157"></a></td><td align="center" class="fluid" style="border-left: solid 4px #ffffff;"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b945e99d0e07fa8adeb22ba7b1b0847c95d5bf8f685ddf118fb2023314ff5e027cb395b8f1e8dbe9973d05baa8c29ab98a7" target="_blank" title="Zip \| Afterpay"><img alt="Zip \| Afterpay" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/35d35318-4c31-4602-8709-74284c64768c.png" style="width: 100%; max-width: 157px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #333333; display: block; padding: 0px; text-align: center;" width="157"></a></td></tr></table></td></tr></table></div><!--[if (gte mso 9)\|(IE)]> </td> <td valign="middle" style="padding:0;"></td> <td width="322" valign="top" style="padding:0;"> <![endif]--><div class="stack-column" style="width:100%;min-width:280px;max-width:50%;display:inline-block;vertical-align:top;"> <table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 2px;"> <table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" class="fluid" style="border-right: solid 4px #ffffff;"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=396de7b3a70b3b94fca56503c7b34d3e04b380c89a19b48f2a880831c9325cd8e2c704afaefacf330d7bfd7f9ff1a38bbac9409080bda672" target="_blank" title="Price Beat Guarantee"><img alt="Price Beat Guarantee" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/3c3ac75b-7660-4055-bc36-f2c6dd3afd9a.png" style="width: 100%; max-width: 157px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #333333; display: block; padding: 0px; text-align: center;" width="157"></a></td><td align="center" class="fluid" style="border-left: solid 4px #ffffff;"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e44432f1d3421152a2a3a1e450bff06721a1fff879e9d219462473a515b2afd5e527a876e9827092fc1601c2659b4230bb" target="_blank" title="Gift Card"><img alt="Gift Card" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/932e61ec-afff-4c27-9fb3-fcc3fc886159.png" style="width: 100%; max-width: 157px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #333333; display: block; padding: 0px; text-align: center;" width="157"></a></td></tr></table></td></tr></table></div><!--[if (gte mso 9)\|(IE)]> </td> </tr> </table> <![endif]--></td></tr></table><!--[if mso \| IE]> </td> </tr> </table> <![endif]--></td></tr></table><!-- O Footer Icons — 2 x 2 Mobile : END --></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr> <td class="stylingblock-content-margin-cell" style="padding: 5px 10px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #143C63; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><!-- N Social Media : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center" style="padding: 20px 10px;"> <table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation"> <tr> <td style="padding: 0 10px; text-align: center; font-family: 'Montserrat', Helvetica, Arial, sans-serif; font-size: 18px; color: #ffffff; font-weight: 700; text-transform: uppercase;" valign="middle"> Follow Us</td><td style="padding: 0 5px;" valign="middle"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e450a72279c1a22aa3a9de11ee5408e1d10995e1ba249a2eb0113dcf53c09f2317e1d6659b0d1f5731f5f4762afde2683b" style="color: #ffffff; text-decoration: none;" title="Instagram"><img alt="Instagram" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/faef85ca-817f-4eb4-9c2a-06c010da9157.png" style="width: 100%; max-width: 28px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #FFFFFF; display: block; padding: 0px; text-align: center;" width="28"></a></td><td style="padding: 0 5px;" valign="middle"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e40ef06362087529ec3185e56291696b7945964cedc16fb88ef2900b83885d726965e54ed3ab3bc2f28923ec855c3ebbe7" style="color: #ffffff; text-decoration: none;" title="Facebook"><img alt="Facebook" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/62a84ef4-2317-4976-a3a3-0bee33097e8b.png" style="width: 100%; max-width: 28px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #FFFFFF; display: block; padding: 0px; text-align: center;" width="28"></a></td><td style="padding: 0 5px;" valign="middle"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e4e4264651b899ee396f15b70db340b06f7b5da2e79b339cdb87fca63ff44fbc51586d92e87327d5d8b28c030998133e8c" style="color: #ffffff; text-decoration: none;" title="YouTube"><img alt="YouTube" src="https://image.s6.sfmc-content.com/lib/fe901370756007757c/m/4/0296b247-338f-412d-8e6a-2580bc01300b.png" style="width: 100%; max-width: 28px; height: auto; font-family: Montserrat, Helvetica, Arial, sans-serif; color: #FFFFFF; display: block; padding: 0px; text-align: center;" width="28"></a></td></tr></table></td></tr></table><!-- N Social Media : END --></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 5px 10px 0px; "> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #005593; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><!-- P Email Footer : BEGIN --><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td align="center"> <!--[if mso]> <table role="presentation" border="0" cellspacing="0" cellpadding="0" align="center" width="640"> <tr> <td align="center" valign="top" width="640"> <![endif]--><table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" style="max-width:640px;" width="100%"> <tr> <td align="center" style="font-size:0; padding: 10px 0;" valign="top"> <!--[if mso]> <table role="presentation" border="0" cellspacing="0" cellpadding="0" align="center" width="640"> <tr> <td align="center" valign="top" width="320"> <![endif]--><div class="stack-column" style="display:inline-block; width:100%; min-width: 300px; max-width:50%; vertical-align:top;"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 10px 0; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e45f4d573554ab1411ea363a6367448c403e4dcff9477f0557f175fa4ed7143a8e02c14584a18225c2b2236166b3c18bbc" style="color:#ffffff;text-decoration:none;" target="_blank" title="Update Details">Update Details</a></td><td style="padding: 10px 0; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e42c6d2478dc716c60a85bc467e376acc47d0a9894c19332f5e33192b054bf5691048815c720d5c4571e8aa9dfddb225d1" style="color:#ffffff;text-decoration:none;" target="_blank" title="Privacy Policy">Privacy Policy</a></td></tr></table></div><!--[if mso]> </td> <td align="center" valign="top" width="320"> <![endif]--><div class="stack-column" style="display:inline-block; width:100%; min-width: 300px; max-width:50%; vertical-align:top;"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 10px 0; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700; line-height:20px; text-align: center;" width="50%"> <a data-linkto="other" href="http://click.e.bcf.com.au/unsub_center.aspx?qs=cf5b34df9a22b6249a84c58e0e6e3a671b7a83589a83a3b388a30a6119086794fa44851a8252e6af66c7e9c4965dc4f105f3a14621e44224b7d86492f39c96c4a79fc74d9d11c44a" style="color:#ffffff;text-decoration:none;" target="_blank" title="Unsubscribe">Unsubscribe</a></td><td style="padding: 10px 0; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif;font-size:13px;font-weight:700; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e474cec70d496915b826910f20910d13ea2f9a1dc195d76aa7482dd7604cb02e2f06b2bf44c6a3ff900484f32afa94a873" style="color:#ffffff;text-decoration:none;" target="_blank" title="Contact Us">Contact Us</a></td></tr></table></div><!--[if mso]> </td> </tr> </table> <![endif]--></td></tr></table><!--[if mso]> </td> </tr> </table> <![endif]--></td></tr><tr> <td class="dontLink" style="padding: 0 20px 20px; text-align: center; font-family: 'Montserrat', Helvetica, Arial, sans-serif; font-size: 11px; line-height: 140%; color: #FFFFFF; font-weight: normal;"> Add <a href="mailto:clubbcf@bcf.com.au" style="color:#FFFFFF; text-decoration: none;">clubbcf@e.bcf.com.au</a> to you contacts to receive the latest and greatest offers. This email was sent to <a href="mailto:aussfdservices@bigpond.com" style="color:#FFFFFF; text-decoration: none;">aussfdservices@bigpond.com</a> and was sent by Club BCF, BCF Australia, <span class="dontLink">6 Coulthards Ave, STRATHPINE, QLD, 4500, Australia</span></td></tr></table><!-- P Email Footer : END --></td></tr></table></td></tr></table><!----><!----><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td class="phone" style="padding: 20px; text-align: center; font-family: 'Open Sans Condensed', Helvetica, Arial, sans-serif; font-size: 24px; color: #005593; font-weight: 700;"> <img align="middle" alt="Call" border="0" class="g-img" height="30" src="http://image.s6.exacttarget.com/lib/fe901370756007757c/m/4/02c06241-fe1a-47fe-814b-d2932c49e57e.png" style="font-family: 'Montserrat', Helvetica, Arial, sans-serif;color: #005593; display:inline-block;" width="30">   <span style="vertical-align:-9px;"><a alias="1300 880 764" conversion="false" data-linkto="other" href="tel:1300 880 764" style="color:#005593;text-decoration:none;" title="1300 880 764">1300 880 764</a></span></td></tr><tr> <td align="center" style="padding: 0 10px;"> <!--[if mso]> <table role="presentation" border="0" cellspacing="0" cellpadding="0" align="center" width="640"> <tr> <td align="center" valign="top" width="640"> <![endif]--><table align="center" border="0" cellpadding="0" cellspacing="0" role="presentation" style="max-width:640px;" width="100%"> <tr> <td align="center" style="font-size:0; padding: 0 0 20px;" valign="top"> <!--[if mso]> <table role="presentation" border="0" cellspacing="0" cellpadding="0" align="center" width="640"> <tr> <td align="center" valign="middle" width="320"> <![endif]--><div class="stack-column" style="display:inline-block; width:100%; min-width: 300px; max-width:50%; vertical-align:middle;"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 5px 0; font-family: 'Montserrat', Helvetica, Arial, sans-serif;font-size:11px;font-weight:normal;text-decoration:none;color:#333333;line-height:20px; text-align: center;" width="50%"> © 2020 BCF Australia</td><td style="padding: 5px 0; font-family: 'Montserrat', Helvetica, Arial, sans-serif;font-size:11px;font-weight:normal; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e488ac5f2984cc0541afbca40bbed2ac909673743d4ad8fd788801db02bc46ac083ca6babe17f7410f17db314d085eab02" style="color:#333333;text-decoration:none;" target="_blank" title="About Us">About Us</a></td></tr></table></div><!--[if mso]> </td> <td align="center" valign="middle" width="320"> <![endif]--><div class="stack-column" style="display:inline-block; width:100%; min-width: 300px; max-width:50%; vertical-align:middle;"> <table border="0" cellpadding="0" cellspacing="0" role="presentation" width="100%"> <tr> <td style="padding: 5px 0; font-family: 'Montserrat', Helvetica, Arial, sans-serif;font-size:11px;font-weight:normal; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=52a69b8bb888b1e4fe09762e2a644d21e8aeaa60a4f16e01ac8c49e7492fef4dc7a0f8f353a75580fb8e92ef676ceddd61552a0208bceb97" style="color:#333333;text-decoration:none;" target="_blank" title="Help Desk">Help Desk</a></td><td style="padding: 5px 0; font-family: 'Montserrat', Helvetica, Arial, sans-serif;font-size:11px;font-weight:normal; line-height:20px; text-align: center;" width="50%"> <a data-linkto="https://" href="http://click.e.bcf.com.au/?qs=f0e5a653e0520e83784f00ead0f0fa9d2504d2ba8a63da6d708bd9344518bafdc8f2ded369fe971eb63ce76693a79345f2b45b3a6714f98f" style="color:#333333;text-decoration:none;" target="_blank" title="Site Map">Site Map</a></td></tr></table></div><!--[if mso]> </td> </tr> </table> <![endif]--></td></tr></table><!--[if mso]> </td> </tr> </table> <![endif]--></td></tr></table></td></tr></table><!----> </td> </tr> </table> <!-- Email Content : END --> </td> </tr> </table> <!--[if mso \| IE]> </td></tr></table> </td></tr></table> <![endif]--> </div> </center> <!--[if !mso]><!-- --> <div class="mobile-hidden" style="display:none;width:0;overflow:hidden;max-height:0!important;"> <img src="http://click.e.bcf.com.au/open.aspx?ffcb10-fe9b10757464047e72-fe2a167577620674721771-fe9612707464027a70-ff66177376-fe3115707262077c721772-ff951274" width="1" height="1"> </div> <!--<![endif]--> </body> </html> --W5FFokFq9oE2=_?:--

| ver. 1.4 | Github | . | PHP 7.4.33 | Generation time: 0 | proxy | phpinfo | Settings