File manager

File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1591286844.M86595P11259.au6.voltdns.com,S=79683,W=80674:2,a

Back
Return-Path: <bounce-94_HTML-25411117-2534963-7004566-160@bounce.email.racq.com.au> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id 4DEBBTwc2V77KwAATr7HEg (envelope-from <bounce-94_HTML-25411117-2534963-7004566-160@bounce.email.racq.com.au>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Fri, 05 Jun 2020 02:07:24 +1000 Return-path: <bounce-94_HTML-25411117-2534963-7004566-160@bounce.email.racq.com.au> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Fri, 05 Jun 2020 02:07:24 +1000 Received: from viclamta38p.bpe.bigpond.com ([203.38.21.102]:50713) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <bounce-94_HTML-25411117-2534963-7004566-160@bounce.email.racq.com.au>) id 1jgsOm-0002sV-8J for ianhamilton@seafoodwarehouse.com.au; Fri, 05 Jun 2020 02:07:24 +1000 Received: from extmail.bigpond.com ([10.10.26.4]) by viclafep38p-svc.bpe.nexus.telstra.com.au with ESMTP id <20200604160638.POYP6064.viclafep38p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Fri, 5 Jun 2020 02:06:38 +1000 X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduhedrudeguddgkeelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpefhvffufffjgghrjefktgesrgdtreertddtjeenucfhrhhomhepfdftteevsfdfuceotghluhgsnhgvfihssegvmhgrihhlrdhrrggtqhdrtghomhdrrghuqeenucggtffrrghtthgvrhhnpeefiefhvdeujeevledtffdtfeejtdfhudejvdduhedtfeeifeffleduveelledtgfenucffohhmrghinheprhgrtghqrdgtohhmrdgruhdprhgrtghqrdgtohhmnecukfhppeduleelrdduvddvrdduvddtrddutdejnecuvehluhhsthgvrhfuihiivgepudduleenucfrrghrrghmpehhvghlohepmhhtrgdrvghmrghilhdrrhgrtghqrdgtohhmrdgruhdpihhnvghtpeduleelrdduvddvrdduvddtrddutdejpdhmrghilhhfrhhomhepoegsohhunhgtvgdqleegpgfjvffonfdqvdehgeduudduudejqddvheefgeelieefqdejtddtgeehieeiqdduiedtsegsohhunhgtvgdrvghmrghilhdrrhgrtghqrdgtohhmrdgruhequceuqfffjgepkeeukffvoffkoffgpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghushhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mta.email.racq.com.au (199.122.120.107) by extmail.bigpond.com (5.8.420) id 5E8A7576101238DA for aussfdservices@bigpond.com; Fri, 5 Jun 2020 02:06:36 +1000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=200608; d=email.racq.com.au; h=From:To:Subject:Date:List-Unsubscribe:MIME-Version:Reply-To:List-ID: X-CSA-Complaints:Message-ID:Content-Type; i=clubnews@email.racq.com.au; bh=xWtJGSfJ/G4a6XXst+dwEaBi/XUgaOHp01NOtrTxGIo=; b=VZkhqDAJooePWs6TDcZGF2nW429VHqWJmMEnF79NstzVX+rOI+Jzc7np0WeAnP9M0dqyof1PjED1 i99ia9ZdsCrqbqiEoiJ2DqFePapo1cA2Yr9KHGHqx10P+CKfHE2GDH5P1op6YXOCdQb9iUz2vKZZ EmHM3cAOZeVq2ZkpWiM= Received: by mta.email.racq.com.au id hr4e0o2fmd4a for <aussfdservices@bigpond.com>; Thu, 4 Jun 2020 07:19:37 +0000 (envelope-from <bounce-94_HTML-25411117-2534963-7004566-160@bounce.email.racq.com.au>) From: "RACQ" <clubnews@email.racq.com.au> To: <aussfdservices@bigpond.com> Date: Thu, 04 Jun 2020 01:19:37 -0600 List-Unsubscribe: <mailto:leave-fd7e1d741a3c402029-fe6916757165057c7413-fe8f167576600d7b76-fe9313707560017b73-ff68157675@leave.email.racq.com.au> MIME-Version: 1.0 Reply-To: "Clubnews" <reply-fe8f167576600d7b76-94_HTML-25411117-7004566-160@email.racq.com.au> List-ID: <7003735.xt.local> X-CSA-Complaints: whitelist-complaints@eco.de X-SFMC-Stack: 6 x-job: 7004566_2534963 Message-ID: <b0485f97-8057-4348-bf98-1176a5f767e6@ind1s06mta1477.xt.local> Content-Type: multipart/alternative; boundary="4Q6VtzO5B4DW=_?:" X-Spam-Status: Yes, score=5.4 X-Spam-Score: 54 X-Spam-Bar: +++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: RACQ http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1a042ec6a820b2ca965145c8825ddff985815c6684a9a14b6d6239a37599a294166459ae7bb75a576b42496fe636130d http://view.email.racq.com.au/?qs=e557aae885084869a8c623c2f4438e433214c46c2a919174376b2d256512f33ef56c7158d48ae41130d447806e8ff0f7ab37986c2166229c809af1ceb5fa27a0b1d916803e83314d1f5504de0c2e8085 View [...] Content analysis details: (5.4 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: racq.com.au] -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [203.38.21.102 listed in list.dnswl.org] 1.1 DATE_IN_PAST_06_12 Date: is 6 to 12 hours before Received: date 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=bounce-94_html-25411117-2534963-7004566-160%40bounce.email.racq.com.au;ip=203.38.21.102;r=au6.voltdns.com] 0.0 HTML_IMAGE_RATIO_06 BODY: HTML has a low ratio of text to image area 0.0 T_KAM_HTML_FONT_INVALID BODY: Test for Invalidly Named or Formatted Colors in HTML 0.0 HTML_MESSAGE BODY: HTML included in message -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid 0.8 CPANEL_LOTS_OF_EMPTY_LINE RAW: Spam that has large block of empty lines 0.0 KAM_SHORT Use of a URL Shortener for very short URL 0.2 KAM_LOTSOFHASH Emails with lots of hash-like gibberish X-Spam-Flag: YES Subject: *SPAM* RACQ Club News - June This is a multi-part message in MIME format. --4Q6VtzO5B4DW=_?: Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 8bit RACQ http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1a042ec6a820b2ca965145c8825ddff985815c6684a9a14b6d6239a37599a294166459ae7bb75a576b42496fe636130d http://view.email.racq.com.au/?qs=e557aae885084869a8c623c2f4438e433214c46c2a919174376b2d256512f33ef56c7158d48ae41130d447806e8ff0f7ab37986c2166229c809af1ceb5fa27a0b1d916803e83314d1f5504de0c2e8085 View in browser Silver member MEMBERSHIP No. 3083670065178547 http://click.email.racq.com.au/?qs=ef95d43b3f24a70c8f88437077196753c5d347c724542e5833fc20c523a89cdb0417e7ca81cb73b6a2097c51800067fa5d8123a9d49bfc74 With the lockdown restrictions easing, it's time to grab a map, get the car ready to hit the road and explore our glorious state! In this special edition of Club News, we want to help you get back out and about. From destinations to visit and member discounts to use along the way, we have your next adventure sorted. http://click.email.racq.com.au/?qs=ef95d43b3f24a70c30c913dd6bb3071d87275d8dbba794e310b5b724f9805107c7e64b6d44aa44260a3eca0ca74db7c1418c6480c3f5db11 http://click.email.racq.com.au/?qs=ef95d43b3f24a70c30c913dd6bb3071d87275d8dbba794e310b5b724f9805107c7e64b6d44aa44260a3eca0ca74db7c1418c6480c3f5db11 Queensland tourism ready to reboot http://click.email.racq.com.au/?qs=ef95d43b3f24a70c30c913dd6bb3071d87275d8dbba794e310b5b724f9805107c7e64b6d44aa44260a3eca0ca74db7c1418c6480c3f5db11 The battered tourism industry is looking ahead to better times. http://click.email.racq.com.au/?qs=ef95d43b3f24a70ce9b8679cab6319a01c24fb9b1c21444a69e4ba387133f94d3e99c2df16e27821b500963d25b2a9d7f404bf1fb6ce184e http://click.email.racq.com.au/?qs=ef95d43b3f24a70ce9b8679cab6319a01c24fb9b1c21444a69e4ba387133f94d3e99c2df16e27821b500963d25b2a9d7f404bf1fb6ce184e Lights, camera, drive-in, action http://click.email.racq.com.au/?qs=ef95d43b3f24a70ce9b8679cab6319a01c24fb9b1c21444a69e4ba387133f94d3e99c2df16e27821b500963d25b2a9d7f404bf1fb6ce184e The Yatala Drive-In has reopened following strict coronavirus guidelines. http://click.email.racq.com.au/?qs=ef95d43b3f24a70c3a917ae854202547ed2ac29d52cef23563d235cb3d8b5765d82c76909bee1e8e92159ce836300a0121419b817641e8bc http://click.email.racq.com.au/?qs=ef95d43b3f24a70c3a917ae854202547ed2ac29d52cef23563d235cb3d8b5765d82c76909bee1e8e92159ce836300a0121419b817641e8bc Family classic http://click.email.racq.com.au/?qs=ef95d43b3f24a70c3a917ae854202547ed2ac29d52cef23563d235cb3d8b5765d82c76909bee1e8e92159ce836300a0121419b817641e8bc Escape the everyday with some good old-fashioned fun on the Sunshine Coast. http://click.email.racq.com.au/?qs=ef95d43b3f24a70c2df9a5f6a9c60cbbba3668e671c6a8531cadb3807627b03fd081dccb3770b6dff71d43f5dca37a184b5294457abe77bc http://click.email.racq.com.au/?qs=ef95d43b3f24a70c2df9a5f6a9c60cbbba3668e671c6a8531cadb3807627b03fd081dccb3770b6dff71d43f5dca37a184b5294457abe77bc Win the ultimate Queensland experience We want you to help us create a list of 150 must do's around Queensland. Learn more about how to enter for your chance to win.^ http://click.email.racq.com.au/?qs=ef95d43b3f24a70c2df9a5f6a9c60cbbba3668e671c6a8531cadb3807627b03fd081dccb3770b6dff71d43f5dca37a184b5294457abe77bc Learn more Great member savings to help you get out and explore By supporting Queensland businesses, we're helping them get back on their feet faster. Save and support Queensland businesses with these member offers. http://click.email.racq.com.au/?qs=ef95d43b3f24a70cdbe4867134c5d3ee98b4e405429478e4e2106febcbac67b448bb341dfd52be37ff7666e0a49b3e85ba46018c74a53312 http://click.email.racq.com.au/?qs=ef95d43b3f24a70cdbe4867134c5d3ee98b4e405429478e4e2106febcbac67b448bb341dfd52be37ff7666e0a49b3e85ba46018c74a53312 Save on a day trip to Fraser Island* http://click.email.racq.com.au/?qs=ef95d43b3f24a70cdbe4867134c5d3ee98b4e405429478e4e2106febcbac67b448bb341dfd52be37ff7666e0a49b3e85ba46018c74a53312 Book now for July, 2020 http://click.email.racq.com.au/?qs=ef95d43b3f24a70c41f5f6a712473564d26e9a24ed75dc7c9d727e0882fdc4a87c773af1aff1147941d109f479079aa445f0ae533df6329f http://click.email.racq.com.au/?qs=ef95d43b3f24a70c41f5f6a712473564d26e9a24ed75dc7c9d727e0882fdc4a87c773af1aff1147941d109f479079aa445f0ae533df6329f Save on a Sea World whale watching cruise with adults at kids prices http://click.email.racq.com.au/?qs=ef95d43b3f24a70c703ff310ee6f5a49a916f87311ca693d48aa1070f9f9abddc8f578e7b8b81ac140b8d103e5c17ad667b28bb13c9a1a55 For travel until 1 November, 2020* http://click.email.racq.com.au/?qs=ef95d43b3f24a70cc986945dd96a84c7bcb756c51c0c944c0ae459a03ab1f70c6d0f8c911886f5e3b362c22e555ff5508d3304e71a5f1536 http://click.email.racq.com.au/?qs=ef95d43b3f24a70cc986945dd96a84c7bcb756c51c0c944c0ae459a03ab1f70c6d0f8c911886f5e3b362c22e555ff5508d3304e71a5f1536 Experience a Noosa Dolphin Kayaking Tour* http://click.email.racq.com.au/?qs=ef95d43b3f24a70cb84697dde69659e21e6c68d831fa5dccc36505964f61a39c74c420b3a3c5f8db9582d161242a2d507a7d9befbb8ce507 http://click.email.racq.com.au/?qs=ef95d43b3f24a70cb84697dde69659e21e6c68d831fa5dccc36505964f61a39c74c420b3a3c5f8db9582d161242a2d507a7d9befbb8ce507 We're here for you and the Queensland community RACQ Foundation was established to support community groups recover from natural disasters. And now we are pleased to extend funding support to community groups or charities who have been impacted by COVID-19. Helping Queenslanders is at the heart of RACQ. Applications are now open.~ http://click.email.racq.com.au/?qs=ef95d43b3f24a70c0791c519f03f028409b35bacd14fea098ab0614c23422e7119b39c0783f35cec4f364a79df040633fa4f1bd4f46338da Apply now Build your financial resilience RACQ is taking our Financial Wellbeing seminars online to help Queenslanders be ready for life's financial challenges. Register now for our webinar on Superannuation.+ When: 18 June Topic: What to do with your super during COVID-19: tips and traps http://click.email.racq.com.au/?qs=ef95d43b3f24a70c635b6dff6669c1d1e896e4ac2390402414904eba6b3816d437633cfd93b15200baffdabf1b29873ded43da10d205f7b6 Learn more http://click.email.racq.com.au/?qs=ef95d43b3f24a70ca2716854b415f57a0a4b800ba7c923143c7d3120269c44ba21a50ce4df42dcf3816939f5ebb1e72608c62ebbfc9df435 http://click.email.racq.com.au/?qs=ef95d43b3f24a70ca2716854b415f57a0a4b800ba7c923143c7d3120269c44ba21a50ce4df42dcf3816939f5ebb1e72608c62ebbfc9df435 Explore the latest news from the digital Road Ahead Read the latest stories highlighting how our state has coped during the COVID-19 pandemic, revealing the famous "Queenslander" spirit has again come to the fore. http://click.email.racq.com.au/?qs=ef95d43b3f24a70ca2716854b415f57a0a4b800ba7c923143c7d3120269c44ba21a50ce4df42dcf3816939f5ebb1e72608c62ebbfc9df435 Read more http://click.email.racq.com.au/?qs=ef95d43b3f24a70c09be7e081c8c452e1f332dbb57b42d6facb2cd0d97ca4e1f8edab9bb326be30d5033416ffc7952e0fc7ef6668480bd31 http://click.email.racq.com.au/?qs=ef95d43b3f24a70ce2c13cbce36bb874eb7417c70e9fb60b4ae59ebeb1a8e7b05829d4d066a95d9b80012a4b25729a1db4245b289520f505 http://click.email.racq.com.au/?qs=ef95d43b3f24a70c4d5afcee324fc49f91a74a37f57e7931b4df0c0f5d9964b99ea2a10813c3f443bec7d9cd5e8d89fd4f8de0ea442970ce http://click.email.racq.com.au/?qs=ef95d43b3f24a70c2c3e39416f3e371b154a7bc44a12bd01fe100028496d1523fdc4933148e983002696da11cf6a01768e8fd7a79d215b29 About http://click.email.racq.com.au/?qs=ef95d43b3f24a70c78ba54f98d0ad8a83534f5dcfc925685ece0562f60baf4d8da14fe8837cf77be7af25c3582f21f05fda427bea4bf1ffa Contact http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1140fd92c908019da0a6331fdba4c56396f24b1fdadf4dfa8cacf88fbddda422bfc3bdc5fc4c1d19bc531a3da6a9a86c Privacy http://click.email.racq.com.au/?qs=ef95d43b3f24a70c6e630073b194862f9459f79783faa5629ac0e795dd3725dbe64ca83cc52c11254b9e44454276b9ad51110216d75cfab1 Login You are currently subscribed to Club News and the digital Road Ahead. To unsubscribe from Club News, http://click.email.racq.com.au/?qs=ef95d43b3f24a70ce9c4cbd3b6e0b4272d9871f42983391a0943f81e7dfd0dcc89c9976ef296cb18db2599c3fcf94412ed6ccc8bb7ac2771 click here . To unsubscribe from the digital Road ahead, http://click.email.racq.com.au/?qs=ef95d43b3f24a70c564be168ea5a4140e0bcc69764fa472c4783803f7593cd34ffb2e7c769cfd6f31d9be51976b4c2d9402165539026ad90 click here . ^Competition terms and conditions apply. Entries are open until 5pm, 19 July 2020. Voting is then open from 27 July - 9 August 2020. Visit http://click.email.racq.com.au/?qs=ef95d43b3f24a70c787aff7ce9fb35b14e90a603e1bddfce8182ac20f39768ecaf13a01e674f9199616f519456887632882aebbc2bda1164 racq.com/mustdoqld for more details. Retail partners, offers and discounts may change at any time without notice. Visit http://click.email.racq.com.au/?qs=ef95d43b3f24a70c162d87d6d2ab12cdd8dab265d7254f27baeb441be363d168981ae8b84be892b03d796c51b0f66089d3668943bbf9bce8 racq.com/discounts or click on the links above for the conditions, limits and exclusions for each offer. ~Terms and conditions apply. Visit http://click.email.racq.com.au/?qs=ef95d43b3f24a70ca4bc8a6c977a037c8f3aa6316fcd20c403c8a6a04ebe17dcd3a2820a067b609e281e42370810e01ae4bba9b5f489eb8c racq.com/foundation for more details. +The information has been prepared for general information purposes. Any advice is general advice and does not take into account any person’s particular investment objectives, financial situation or needs. Before acting on anything based on this advice you should consider its appropriateness to you, having regard to your objectives, financial situations and needs. This email was sent by: RACQ, 2649 Logan Road Eight Mile Plains QLD, 4113, Australia --4Q6VtzO5B4DW=_?: Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: 8bit <!doctype html><html><head><meta http-equiv="Content-Type" content="text/html; charset=utf-8"><meta name="format-detection" content="telephone=no"><meta name="viewport" content="width=device-width, initial-scale=1.0"><title>RACQ</title><style type="text/css"> body { background: #ffffff !important; background-color: #ffffff !important; margin: 0 !important; } .ReadMsgBody { width: 100%; } / Forces Hotmail to display emails at full width / .ExternalClass { width: 100%; } /Hotmail table centering fix/ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass font, .ExternalClass td, .ExternalClass div { line-height: 100%; } /* Forces Hotmail to display normal line spacing/ p { margin: 1em 0; } /Yahoo paragraph fix/ table td { border-collapse: collapse; } /This resolves the Outlook 07, 10, and Gmail td padding issue fix/ /This resolves the issue when iphone puts links on dates, etc./ a[x-apple-data-detectors], .unstyle-auto-detected-links a, .aBn { border-bottom: 0 !important; cursor: default !important; color: inherit !important; text-decoration: none !important; font-size: inherit !important; font-family: inherit !important; font-weight: inherit !important; line-height: inherit !important; } a:link { color: #000001; text-decoration: none; } a:active { color: #000001; text-decoration: none; } a:visited { color: #0475d7 !important; text-decoration: none; } a:hover { color: #0475d7 !important; text-decoration: none; } textarea { resize: none; } textarea:focus, input:focus { outline: none; } .appleLinksblue a { color: #4375b6 !important; text-decoration: none; } .appleLinksorange a { color: #e7b357 !important; text-decoration: none; } .appleLinksgrey a { color: #444444 !important; text-decoration: none; } img { display: block !important; border: 0px !important; border: none !important; } a img { display: block !important; border: 0px !important; border: none !important; } @-ms-viewport { width: device-width; } / New Header Style : BEGIN / @media screen and (max-width: 600px) { .header { width: 100% !important; min-width: 100% !important; margin: auto !important; } } @media only screen and (max-device-width: 414px) { .fs-8 { font-size: 8px !important; } .fs-10 { font-size: 10px !important; } } / New Header Style : END / / Header class / @media screen and (max-width: 480px) { .mobile-display { display: block !important; height: auto !important; width: 100% !important; overflow: visible !important; max-height: 100% !important; visibility: visible !important; line-height: normal !important; } .mobile-hidden-header { display:none !important; font-size: 0; max-height: 0; line-height: 0; mso-hide:all; } .logo-mobile img{ width: 110px !important; height: 39px !important; } .padding-left-5{ padding-left: 5px !important; } .font-10 { font-size: 10px !important; } .font-8{ font-size: 7px !important; } } @media screen and (max-width: 320px) { .logo-mobile img{ width: 90px !important; height: 32px !important; } .font-10 { font-size: 10px !important; } .font-8{ font-size: 6px !important; } } #MessageViewBody .mobile-display { display: block !important; height: auto !important; width: 100% !important; overflow: visible !important; max-height: 100% !important; visibility: visible !important; line-height: normal !important; } #MessageViewBody .mobile-hidden-header { display:none !important; font-size: 0; max-height: 0; line-height: 0; mso-hide:all; } #MessageViewBody .logo-mobile img{ width: 90px !important; height: 32px !important; } #MessageViewBody .padding-left-5{ padding-left: 5px !important; } #MessageViewBody .font-10 { font-size: 10px !important; } #MessageViewBody .font-8{ font-size: 7px !important; } / End of Header class / / ================================================================= / @media screen and (max-width: 600px) { body { background: #ffffff !important; background-color: #ffffff !important; } .grey-spacer{ background: #ffffff !important; background-color: #ffffff !important; } .resize-width { width: 100% !important; height: auto !important; } } / Media query triggers alternate styles when the file is displayed on a device with a maximum width lower than the assigned pixel dimension. The default max width setting for max-width should be 480px to trigger on mobile devices. / / ================================================================= / @media only screen and (max-width: 480px) { .grey-spacer{ background: #ffffff !important; background-color: #ffffff !important; } body { background: #ffffff !important; background-color: #ffffff !important; } / Resets the width of the body content. Called container simply because it's the bucket the rest of the content sits inside. / body[yahoo] .container { width: 100% !important; } / Hides content from the mobile view / body[yahoo] .mobile-hidden { display: none !important; } / Scales down fixed width images to 100% in mobile view / body[yahoo] .photo { width: 100% !important; height: auto !important; } /drops the right column under the left column/ body[yahoo] .drop { width: 100% !important; float: left !important; } /puts a hard break in the mobile version/ body[yahoo] .break { display: block !important; } / Shows elements mobile-hidden from the desktop view in the mobile version. It is best to place this class in a div surrounding the element you want to hide on desktop / body[yahoo] .show { display: block !important; margin: 0 !important; padding: 0 !important; overflow: visible !important; width: auto !important; max-height: none !important; } body[yahoo] .spacer { width: 42px !important; } body[yahoo] .spacer1 { width: 13px !important; } body[yahoo] .font13 { font-size: 13px !important; } body[yahoo] .font14 { font-size: 14px !important; padding-top: 14px !important; padding-bottom: 14px !important; } body[yahoo] .font22 { font-size: 22px !important; line-height: 30px !important; mso-line-height-rule: exactly !important; } body[yahoo] .font22line { font-size: 22px !important; } body[yahoo] .font20 { font-size: 20px !important; line-height: 30px !important; mso-line-height-rule: exactly !important; } body[yahoo] .contentspad { padding-top: 7px !important; padding-left: 20px !important; padding-right: 20px !important; padding-bottom: 7px !important; } body[yahoo] .padleft { padding-left: 0px !important; } body[yahoo] .padleftright { padding-left: 10px !important; padding-right: 10px !important; } body[yahoo] .footerpad { padding-left: 20px !important; padding-right: 20px !important; } body[yahoo] .spacer2 { width: 60px !important; } body[yahoo] .spacer3 { width: 1px !important; } body[yahoo] .spacer4 { width: 20px !important; } / additional css/ body[yahoo] .contentspad1{ padding-top:7px !important; padding-left:0px !important; padding-right:0px !important; padding-bottom:7px !important; } body[yahoo] .font23 { font-size: 23px !important; line-height: 26px !important; } body[yahoo] .font15 { font-size: 15px !important; line-height: 20px !important; width:100%; } body[yahoo] .mobileimg1 { width: 278px !important; height: 268px !important; } body[yahoo] .mobileimg2 { width: 240px !important; height: 50px !important; } body[yahoo] .hrline { width: 100% !important; height: 1px !important; } body[yahoo] .free { padding-left: 18px !important; padding-right:18px !important; } body[yahoo] .font21 { font-size: 21px !important; } body[yahoo] .mobile-text { font-family: Arial,Verdana,Helvetica,sans-serif !important; font-size: 21px !important; color: #003478 !important; font-weight: bold !important; text-decoration: none !important; display: block !important; font-style:italic !important; } body[yahoo] .mobile-text:after { content: "Download the app"; } body[yahoo] .mobile-text1 { font-family: Arial,Verdana,Helvetica,sans-serif !important; font-size: 21px !important; color: #003478 !important; font-weight: bold !important; text-decoration: none !important; display: block !important; font-style:italic !important; } body[yahoo] .mobile-text1:after { content: "Enter now"; } body[yahoo] .mobile-text2 { font-family: Arial,Verdana,Helvetica,sans-serif !important; font-size: 21px !important; color: #003478 !important; font-weight: bold !important; text-decoration: none !important; display: block !important; font-style:italic !important; } body[yahoo] .mobile-text2:after { content: "Shop now"; } body[yahoo] .mobile-text3 { font-family: Arial,Verdana,Helvetica,sans-serif !important; font-size: 21px !important; color: #003478 !important; font-weight: bold !important; text-decoration: none !important; display: block !important; font-style:italic !important; } body[yahoo] .mobile-text3:after { content: "Call to action"; } } </style></head><body style="margin: 0px; padding:0px; -webkit-text-size-adjust:none; -ms-text-size-adjust: none;" yahoo="fix"><style type="text/css"> div.preheader { display: none !important; } </style> <div class="preheader" style="font-size: 1px; display: none !important;">Latest news and member offers!</div><img src="http://click.email.racq.com.au/open.aspx?ffcb10-fe8f167576600d7b76-fe5f1177716400797413-fe9313707560017b73-ff921d74-fe6916757165057c7413-ff68157675" width="1" height="1"><table width="100%" border="0" cellspacing="0" cellpadding="0"><tr><td align="center" valign="top"><table width="600" border="0" cellspacing="0" cellpadding="0" class="container"><tr><td valign="top" align="left"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 5px; " class="stylingblock-content-wrapper camarker-inner"><!-- Header : BEGIN --> <table align="center" cellspacing="0" cellpadding="0" border="0" width="600" style="margin: auto; width: 600px; min-width: 600px;" class="header"> <tr> <td style="padding: 0px; background-color: #4b5869;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td style="padding: 0px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td style="padding: 0px; vertical-align: top;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td style="padding: 25px 20px 5px; text-align: left;"> <a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1a042ec6a820b2ca965145c8825ddff985815c6684a9a14b6d6239a37599a294166459ae7bb75a576b42496fe636130d" target="_blank"> <img src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/dea3dca1-1fa0-48a5-b796-fa6375a9913f.png" width="149" height="54" alt="RACQ" border="0" style="display: block;"> </a> </td> </tr> </table> </td> <td style="padding: 0px; vertical-align: top;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td style="padding: 5px 20px 5px; text-align: right; font-size: 10px; line-height: 10px; font-family: Arial, sans-serif; color: #b4b8be;"> <a href="http://view.email.racq.com.au/?qs=e557aae885084869a8c623c2f4438e433214c46c2a919174376b2d256512f33ef56c7158d48ae41130d447806e8ff0f7ab37986c2166229c809af1ceb5fa27a0b1d916803e83314d1f5504de0c2e8085" target="_blank" style="color: #b4b8be; text-decoration: underline;"> View in browser </a> </td> </tr> </table> </td> </tr> </table> </td> </tr> <tr> <td height="28" style="padding: 0px; height: 28px;"> <table align="right" border="0" cellpadding="0" cellspacing="0" style="border-collapse: separate !important; background-color: #A5B9C4;"> <tr> <td style="padding: 0px;"> <table border="0" cellpadding="0" cellspacing="0"> <tr> <td style="padding: 0px; text-align: right;"> <img src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/c0ddd1c7-a463-4d04-8bb4-5858694a4116.png" width="40" height="28" border="0" style="display: block;"> </td> <td style="padding: 0px; vertical-align: top;"> <table border="0" cellpadding="0" cellspacing="0"> <tr> <td style="border-top: 6px solid #A5B9C4; padding: 2px 0px 0px; text-align: center; white-space: nowrap; font-family: Arial, sans-serif; font-size: 14px; line-height: 12px; color: #FFFFFF; vertical-align: bottom;" class="fs-10"> Silver member </td> </tr> </table> </td> </tr> </table> </td> <td style="padding: 0px;"> <table border="0" cellpadding="0" cellspacing="0"> <tr> <td style="padding: 0px; text-align: right;"> <img src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/611f1e0c-1043-4849-84d4-002c1527db63.png" width="31" height="28" border="0" style="display: block;"> </td> <td style="padding: 0px; background-color: #95A8B2; vertical-align: top;"> <table border="0" cellpadding="0" cellspacing="0"> <tr> <td style="border-top: 6px solid #A5B9C4; padding: 4px 10px 0px 0px; text-align: center; white-space: nowrap; font-family: Arial, sans-serif; font-size: 12px; line-height: 12px; color: #FFFFFF; vertical-align: bottom;" class="fs-8"> MEMBERSHIP No. 3083670065178547 </td> </tr> </table> </td> </tr> </table> </td> </tr> </table> </td> </tr> </table> </td> </tr> </table> <!-- Header : END --></td></tr></table> </td></tr></table></td></tr><tr><td valign="top" align="center"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdcdfd55a64269e43af6333cdc12ef358e98ca9b1937893d8a6304943b1a1e9c93108d790d9a302c1cef390dea45de5d97" title="The Queensland road trip is back" data-linkto="https://"><img data-assetid="74598" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/5b862b5d-1d58-4c37-a9db-c93957299e31.jpg" alt="The Queensland road trip is back" height="300" width="600" style="display: block; padding: 0px; text-align: center; height: 300px; width: 600px; border: 0px;"></a></td></tr></table></td></tr></table> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px 20px 20px; " class="stylingblock-content-wrapper camarker-inner"><p> <span style="font-size:16px;"><span align="left" style="color:#4b5869;"><span style="font-family:arial,helvetica,sans-serif;">With the lockdown restrictions easing, it's time to grab a map, get the car ready to hit the road and explore our glorious state!<br> <br> In this special edition of Club News, we want to help you get back out and about. From destinations to visit and member discounts to use along the way, we have your next adventure sorted.</span></span></span></p></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 50%; padding-right: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"> <a href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdf5ee9b7dff9e01e3870574309a4d9acd8ce69d7e5cffd6b7918c316a755894e9f7b769894f2feac7f49a95faf7dad077" title="Queensland tourism ready to reboot" data-linkto="https://"><img data-assetid="74439" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/aa115e80-0704-43fb-9cc0-120f27f80009.jpg" alt="Queensland tourism ready to reboot" height="144" width="280" style="display: block; padding: 0px; text-align: center; height: 144px; width: 280px; border: 0px;"></a></td></tr></table></td></tr></table></td> <td valign="top" class="responsive-td" style="width: 50%; padding-left: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding-bottom: 10px; " class="stylingblock-content-wrapper camarker-inner"><div align="left"> <span style="font-size:18px;"><span align="left" style="color:#003478;"><span style="font-family:arial,helvetica,sans-serif;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd2fa27d326d1a653f193c44e6165c891176e0dd2ff81d76a807c8756d6d656362e71949f007187725c4d13af0b3f7774f" style="color:#003478;text-decoration:none;" title="Queensland tourism ready to reboot">Queensland tourism ready to reboot</a></span></span></span><br> <br> <span style="font-size:16px;"><span align="left" style="color:#003478;"><span style="font-family:arial,helvetica,sans-serif;"><span style="font-size:16px;"><span align="left" style="color:#4b5869;"><span style="font-family:arial,helvetica,sans-serif;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fda0436542cea30654b35809ae440c29d4e6964ea8d3ce3a32b8b7f28d016c08f4c6ae76d309768e4292250c01bb1037fa" style="color:#4b5869;text-decoration:none;" title="Queensland tourism ready to reboot">The battered tourism industry is looking ahead to better times.</a></span></span></span></span></span></span></div></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr><tr><td valign="top" align="left"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 50%; padding-right: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; border-top: 0px; border-right: 0px; border-bottom: 5px solid #FFE600; border-left: 0px; " class="stylingblock-content-wrapper"><tr> <td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cd85b6372073c6ad809d1e864ca1058e768f0b36dd25fbd6525d101395d830bb317903bf6f7d33bc6a2c1de44a533b90e" title="Lights, camera, drive-in, action" data-linkto="https://"><img data-assetid="74437" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/277e43cc-5bf1-4aae-a5b7-7eb2c6e9e18a.jpg" alt="Lights, camera, drive-in, action" height="144" width="280" style="display: block; padding: 0px; text-align: center; height: 144px; width: 280px; border: 0px;"></a></td></tr></table></td></tr></table> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: left; line-height: 115%;"> <span style="font-family:Arial,Helvetica,sans-serif;"><span style="color:#003478;"><span style="font-size:18px;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70caf88046a9362a708d5323eaa87c6a35c9545d2447746dbdb73d6401ec21f8bc4be94a02579c34f5a68291ce79c83dbd1" style="color:#003478;text-decoration:none;" title="Lights, camera, drive-in, action">Lights, camera, drive-in, action</a></span></span><br> <br> <span style="font-size:16px"><font color="#4b5869"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c9fbfb021286b95eebc428bfe32000b1569cbcc2fd28ff71f4ed81f5bc7439f9b2586a778cd8b9949e4e1a9b1fb0b0100" style="color:#4b5869;text-decoration:none;" title="The Yatala Drive-In has reopened following strict coronavirus guidelines.">The Yatala Drive-In has reopened following strict coronavirus guidelines.</a></font></span></span> </div></td></tr></table></td><td valign="top" class="responsive-td" style="width: 50%; padding-left: 5px;"> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; border-top: 0px; border-right: 0px; border-bottom: 5px solid #FFE600; border-left: 0px; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c7e78c4fa302f713f8382328cc4f05ae0c05b3ea3b3374ca48c1d814277ee1b96d67c698ca84c5bc8dbb3bf7911b3e37c" title="Family classic" data-linkto="https://"><img data-assetid="74790" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/c475b073-5b8d-48c6-84e5-bad79c85b322.jpg" alt="Family classic" height="144" width="280" style="display: block; padding: 0px; text-align: center; height: 144px; width: 280px; border: 0px;"></a></td></tr> </table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: left; line-height: 115%;"> <span style="color:#003478;"><span style="font-size:18px;"><span style="font-family:Arial,Helvetica,sans-serif;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c40bd61975f04a602f4a6fa327e7690055049b88d32a8045876941054e8daee5b19cdd18bc400991721bb980dc88ff417" style="color:#003478;text-decoration:none;" title="Family classic">Family classic</a></span></span></span><br> <br> <span style="font-size:16px;"><span style="color:#4b5869;"><span style="font-family:Arial,Helvetica,sans-serif;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c14262820f121962fff57773b4d9194827078e0c38356ddab692630eddf238d3df25e08ba579d152720f60d8171d10aee" style="color:#4b5869;text-decoration:none;" title="Escape the everyday with some good old-fashioned fun on the Sunshine Coast.">Escape the everyday with some good old-fashioned fun on the Sunshine Coast.</a></span></span></span></div></td></tr></table></td></tr></table></td></tr></table></td></tr></table> </td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 50%; padding-right: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fddffeb1b33cb705f1cdfd4c86ec93df731cb4b66dc8e8f6b96ef3ab4ae59e4815fe58ee820c543deb937f90b95efdc9c4" title="Win the ultimate Queensland experience" data-linkto="https://"> <img data-assetid="74597" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/8215abf6-40e6-4025-b8cb-1fae9617d9e3.jpg" alt="Win the ultimate Queensland experience" height="144" width="280" style="display: block; padding: 0px; text-align: center; height: 144px; width: 280px; border: 0px;"></a></td></tr></table></td></tr></table></td> <td valign="top" class="responsive-td" style="width: 50%; padding-left: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding-bottom: 10px; " class="stylingblock-content-wrapper camarker-inner"><div align="left"> <span style="font-size:18px;"><span align="left" style="color:#003478;"><span style="font-family:arial,helvetica,sans-serif;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd4f28845fb7b322ffe362f44140f420091e1ee63f2d0055a8bf968ca4ea5d8bb5fa02b4f27d70ed9cc44705597b6c2dd0" style="color:#003478;text-decoration:none;" title="Win the ultimate Queensland experience">Win the ultimate Queensland experience</a></span></span></span><br> <br> <span style="font-size:16px;"><span align="left" style="color:#003478;"><span style="font-family:arial,helvetica,sans-serif;"><span style="font-size:16px;"><span align="left" style="color:#4b5869;"><span style="font-family:arial,helvetica,sans-serif;">We want you to help us create a list of 150 must do's around Queensland. Learn more about how to enter for your chance to win.^</span></span></span></span></span></span></div></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" border="0" cellspacing="0" cellpadding="0"><tr><td align="left"><table border="0" cellspacing="0" cellpadding="0"><tr><td class="innertd buttonblock" bgcolor="#FFEE00" style=" border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px; background-color: #FFEE00;"> <a target="_blank" class="buttonstyles" style=" font-size: 16px; font-family: Arial, Helvetica, sans-serif; color: #003478; text-align: left; text-decoration: none; display: block; font-weight: bold; background-color: #FFEE00; border: 1px solid #FFEE00; padding: 10px; border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px;" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdfe5e34ce04cb8a35d349149c543496e7b3a772583585274e1ed87a1416d7b7ea69f009efac3b58f108b5fbdddfbd966f" title="Learn more" data-linkto="https://">Learn more</a></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px 20px 20px; " class="stylingblock-content-wrapper camarker-inner"><p> <b><span style="color:#003478; font-family: arial, helvetica, sans-serif; font-size: 24px;">Great member savings to help you get out and explore</span></b><br> <br> <span style="font-size:16px;"><span align="left" style="color:#4b5869;"><span style="font-family:arial,helvetica,sans-serif;">By supporting Queensland businesses, we're helping them get back on their feet faster. Save and support Queensland businesses with these member offers.</span></span></span></p></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 15px 0px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 33%; padding-right: 0px;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"> <a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c6ce8829ee6e9b4a59b0bab09c9648eee8004927a67d16fdbe76033c1182c86e9194a62fbc2d33844b8eb158bc084e010" title="Fraser Island " data-linkto="https://"><img data-assetid="74873" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/c379158c-dcbb-45ee-a6ba-a6559872b417.jpg" alt="Fraser Island" height="198" width="187" style="display: block; padding: 0px 5px 0px 0px; text-align: center; height: 198px; width: 187px; border: 0px;"></a></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 9px 0px 4px; "> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; border-top: 5px solid #FFE600; border-right: 0px; border-bottom: 0px; border-left: 0px; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: center;"> <span style="color:#003478;"><span style="font-size:16px;"><span style="font-family: arial, helvetica, sans-serif; text-align: center;"><b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cc626ddbb036c79af3a566f61c66feec344a814bacaf181f1141dfc1bf9406fb701f20c853309ec925cd3cb6cb5168219" style="color:#003478;text-decoration:none;" title="Save on a day trip to Fraser Island">Save on a day trip to Fraser Island</a></b><br> <a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c86b0ee0c6bac655b8cf304d5243ac406395a1e5cb07832c5e770088544e4cd9795e0738cba67bef658b12f49c3f90f4c" style="color:#003478;text-decoration:none;" title="Book now for July, 2020">Book now for July, 2020</a></span></span></span></div><div style="text-align: center;"> <br>  </div></td></tr></table></td></tr></table></td><td valign="top" class="responsive-td" style="width: 33%; padding-left: 0px; padding-right: 0px;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cff9c642ca1f4f82bf48d0af209ba879cf77e67c3a7bd8b2abaa84611275b4fa23f799fdadc760141991804266af07291" title="Sea World Whale watching cruise" data-linkto="https://"> <img data-assetid="74872" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/6e61a0b3-b487-4a58-b148-7383d10f5abb.jpg" alt="Sea World Whale watching cruise" height="198" width="187" style="display: block; padding: 0px; text-align: center; height: 198px; width: 187px; border: 0px;"></a></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 7px 0px 5px; "> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; border-top: 5px solid #FFE600; border-right: 0px; border-bottom: 0px; border-left: 0px; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: center;"> <span style="text-align: center;"><b style="color: rgb(0, 52, 120); font-family: arial, helvetica, sans-serif; font-size: 16px;"> <a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c2f6ea642e56c24cb2e2dc29f832929833745c44884c52d1526750b8bb4048ee81c89620c0ac61d41cfca7c60c11db533" style="color:#003478;text-decoration:none;" title="Save on a Sea World whale watching cruise with adults at kids prices">Save on a Sea World whale watching cruise with adults at kids prices</a></b></span></div><div style="text-align: center;"> <span style="color:#003478;"><span style="font-size:16px;"><span style="font-family: arial, helvetica, sans-serif; text-align: center;"><a data-linkto="http://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cb4eae60fec746b1754b7a905e24cf585edc690cb26577b9a1db354c2fbdcbb78a9e65430d2580ed5431b5b3900ee8b21" style="color:#003478;text-decoration:none;" title="For travel until 1 November, 2020">For travel until 1 November, 2020</a></span></span></span></div></td></tr></table></td></tr></table></td><td valign="top" class="responsive-td" style="width: 33%; padding-left: 0px;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"> <table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c8938d022231f534ec473d98b93e86e86cff5c89c7d8c7e524d5aab160b8f24f1598b6487448a7a61a71ad91823f35a99" title="Noosa Dolphin Kayaking Tour" data-linkto="https://"><img data-assetid="74871" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/0c2c56f9-3342-496d-976b-478db741b6c1.jpg" alt="Noosa Dolphin Kayaking Tour" height="198" width="187" style="display: block; padding: 0px; text-align: center; height: 198px; width: 187px; border: 0px;"></a></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 0px 7px 0px 6px; "> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; border-top: 5px solid #FFE600; border-right: 0px; border-bottom: 0px; border-left: 0px; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: center;"> <span style="color:#003478;"><span style="font-size:16px;"><span style="font-family: arial, helvetica, sans-serif; text-align: center;"><b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c9c9ab92bd554e3ffc955a4ec909ed59ad78f30c59fc848d4bfc8ca9585b39443155fe9d8b350dd4283c5c29cd0ca9510" style="color:#003478;text-decoration:none;" title="Experience a Noosa Dolphin Kayaking Tour">Experience a Noosa Dolphin Kayaking Tour</a></b></span></span></span><br> <br> <br>  </div></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table> </td></tr></table></td></tr><tr><td valign="top" align="left"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><table bgcolor="" border="0" bordercolor="" cellpadding="0" cellspacing="0" width="100%"> <tr> <td style="font-family:Arial; font-size:13px"> <table bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="600px"> <tr> <td align="left" class="contentspad" style="padding: 15px 10px;" valign="top"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" style="color: #003478; font-family: Arial, Helvetica, sans-serif; font-size: 18px; font-weight: bold;" valign="top"> <a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd290f9f33a995a173077eb61d01df3a7aff0e89908dbc554de112d9e22cf3b797e16fc7e7253bbd6c35a9580483351872" title="RACQ Travel"><img alt="RACQ Travel" data-assetid="74908" height="98" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/75991e56-833e-4f2d-88e5-c3c03da6e8e1.jpg" style="height: 98px; width: 290px; padding: 0px; margin: 0px; text-align: center;" width="290"></a></td><td align="left" class="drop" style="color: #003478; font-family: Arial, Helvetica, sans-serif; font-size: 18px; font-weight: bold;" valign="top"> <a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd910ad30e10ecf2b931476f28c55a34e659a0481081d8b6704ab8c4b2302856f2d0551c073d700ba4807c85702f5af44f" style="text-decoration:none;" title="RACQ Travel"><img alt="RACQ Travel" data-assetid="74907" height="98" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/7bff37ea-e441-4c28-8baa-48e7b029cead.jpg" style="height: 98px; width: 290px; padding: 0px; margin: 0px; text-align: center;" width="290"></a></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr><tr><td valign="top" align="left"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #003478; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 30px 50px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td> <table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 100%;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 15px; " class="stylingblock-content-wrapper camarker-inner"><p style="font-family: Arial, Verdana, Helvetica, sans-serif; font-size: 18px; color: rgb(75, 88, 105); line-height: 23px; margin: 0px; text-align: center;"> <b><span style="color:#FFE600;">We're here for you and the Queensland community</span></b></p></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 15px; " class="stylingblock-content-wrapper camarker-inner"><p style="font-family: Arial, Verdana, Helvetica, sans-serif; font-size: 14px; color: rgb(75, 88, 105); line-height: 23px; margin: 0px; text-align: center;"> <span style="color:#ffffff;">RACQ Foundation was established to support community groups recover from natural disasters. And now we are pleased to extend funding support to community groups or charities who have been impacted by COVID-19. Helping Queenslanders is at the heart of RACQ.<br> <br> Applications are now open.<sup>~</sup></span></p></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" border="0" cellspacing="0" cellpadding="0"><tr><td align="center"><table border="0" cellspacing="0" cellpadding="0"><tr><td class="innertd buttonblock" bgcolor="transparent" style=" border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px; background-color: transparent;"> <a target="_blank" class="buttonstyles" style=" font-size: 16px; font-weight: bold; font-family: Arial, Helvetica, sans-serif; color: #FFE600; text-align: center; text-decoration: none; display: block; background-color: transparent; border: 1px solid #FFE600; padding: 10px; border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px;" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd7bb01c8ba5a84c9cd422e826d55a41a85c6c4196408b786da5c782012e748c320d79351e4d5672ab3d7f521773bcefa3" title="Apply now" data-linkto="https://">Apply now</a></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #EDEEF0; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 20px 30px 10px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td> <table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 100%;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 15px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><img data-assetid="74894" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/216ddee2-76e1-4110-84e2-b8cd5e5eca33.png" alt="Laptop icon" height="60" width="60" style="display: block; padding: 0px; text-align: center; height: 60px; width: 60px; border: 0px;"></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr> <td style="padding: 0px 0px 10px; " class="stylingblock-content-wrapper camarker-inner"><div style="text-align: center;font-family:Arial,Verdana,Helvetica,sans-serif;font-size:18px;color:#003478;line-height:20px;margin:0;font-weight:bold"> Build your financial resilience</div></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 15px; " class="stylingblock-content-wrapper camarker-inner"><p style="font-family: Arial, Verdana, Helvetica, sans-serif; font-size: 14px; color: rgb(75, 88, 105); line-height: 23px; margin: 0px; text-align: center;"> RACQ is taking our Financial Wellbeing seminars online to help Queenslanders be ready for life's financial challenges. Register now for our webinar on Superannuation.<sup>+</sup><br> <br> <b>When</b>: 18 June<br> <b>Topic</b>: What to do with your super during COVID-19: tips and traps</p></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px 0px 10px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" border="0" cellspacing="0" cellpadding="0"><tr><td align="center"><table border="0" cellspacing="0" cellpadding="0"><tr><td class="innertd buttonblock" bgcolor="#FFE600" style=" border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px; background-color: #FFE600;"> <a target="_blank" class="buttonstyles" style=" font-size: 16px; font-family: Arial, Helvetica, sans-serif; font-weight: bold; color: #003478; text-align: center; text-decoration: none; display: block; background-color: #FFE600; border: 1px solid #FFE600; padding: 10px; border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px;" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdc9c86066a2cea571c093c5c42e8f0707622f80a86332bf0dc3e1f9ab8a4874ff3e4fe671bf48ec5ef6ebf4eee08c5bde" title="Learn more" data-linkto="https://">Learn more</a></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" class="stylingblock-content-wrapper" style="min-width: 100%; "><tr><td class="stylingblock-content-margin-cell" style="padding: 10px 5px; "><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #FFFFFF; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px; " class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td><table cellspacing="0" cellpadding="0" style="width: 100%;"><tr><td valign="top" class="responsive-td" style="width: 30%; padding-right: 5px;"> <table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 20px; " class="stylingblock-content-wrapper camarker-inner"><table width="100%" cellspacing="0" cellpadding="0"><tr><td align="center"><a href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1cfaf189ec064a91c05d540d0d938f35217ef2a40fdb47523684194fec852eac958fef784c38257992630ae3642d9349" title="The Road Ahead" data-linkto="https://"><img data-assetid="74532" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/13/da18b712-52d2-4f34-a89c-8f8ce9751f0d.jpg" alt="The Road Ahead" height="187" width="140" style="display: block; padding: 0px; text-align: center; height: 187px; width: 140px; border: 0px;"></a></td></tr></table></td></tr></table></td> <td valign="top" class="responsive-td" style="width: 70%; padding-left: 5px;"><table cellpadding="0" cellspacing="0" width="100%" style="background-color: transparent; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 10px 0px 22px; " class="stylingblock-content-wrapper camarker-inner"><div align="left"> <span align="left" style=""><span align="left" style=""><b style="color: rgb(0, 52, 120); font-family: arial, helvetica, sans-serif; font-size: 18px;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cbc77695a696959708dd0d420ceb40002a3cd22da3f666379f8f89d3f056b220adb10f70fcec72486fcc0c2df4dbb637d" style="color:#003478;text-decoration:none;" title="Explore the latest news from the digital Road Ahead">Explore the latest news from the digital <i>Road Ahead</i></a></b><br> <br> <span align="left" style=""><font color="#4b5869" face="arial, helvetica, sans-serif">Read the latest stories highlighting how our state has coped during the COVID-19 pandemic, revealing the famous "Queenslander" spirit has again come to the fore.</font></span></span></span></div></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table width="100%" border="0" cellspacing="0" cellpadding="0"><tr><td align="left"><table border="0" cellspacing="0" cellpadding="0"><tr> <td class="innertd buttonblock" bgcolor="#FFEE00" style=" border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px; background-color: #FFEE00;"><a target="_blank" class="buttonstyles" style=" font-size: 16px; font-family: Arial, Helvetica, sans-serif; color: #003478; text-align: left; text-decoration: none; display: block; font-weight: bold; background-color: #FFEE00; border: 1px solid #FFEE00; padding: 10px; border-radius: 6px; -moz-border-radius: 6px; -webkit-border-radius: 6px;" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cde08344de4b34ccef9d15303b05b2dcdd508f26d3682db541c90e233bd9ce9b48818b6b308e119f1cdbaad499154099c" title="Read more" data-linkto="https://">Read more</a></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table></td></tr></table> </td></tr></table></td></tr><tr><td valign="top" align="center"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><style type="text/css"> /* MOBILE STYLES - Media All / @media all { a:hover { color: #0475fb !important; } a:visited { color: #4b5869 !important; } }</style><table bgcolor="#edeef0" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" class="contentspad" style="padding: 5px 10px;" valign="top"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" style="color: rgb(1, 51, 120); font-family: Arial,Helvetica,sans-serif; font-size: 10px; font-weight: bold;" valign="middle"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd9f54ee09efdb6c81401f160f1dd7ff928449b8fe2895e1ebbd7a4effced5654222bea9da05031889c5d61c8c947ac73e" style="font-size: 13px; font-weight: normal;" target="_blank" title=""><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><img alt="Facebook" height="60" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/4/cn-ico-img-fbk.gif" style="display: block;" title="Visit us on Facebook" width="50"></font></a></font></font></b></td><td align="center" style="color: rgb(1, 51, 120); font-family: Arial,Helvetica,sans-serif; font-size: 10px; font-weight: bold;" valign="middle"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fd1fe714b4d6759af3dcacd965f6fc35c80204bbbe97554066c763bd40ba06806bb272a3677035dc44192abc5c0d022783" style="font-size: 13px; font-weight: normal;" target="_blank" title=""><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><img alt="Twitter" height="60" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/4/cn-ico-img-twtr.gif" style="display: block;" title="Send us a tweet." width="55"></font></a></font></font></b></td><td align="center" style="color: rgb(1, 51, 120); font-family: Arial,Helvetica,sans-serif; font-size: 10px; font-weight: bold;" valign="middle"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdc005e905ea3b3a26fd4e14deae602fe1db07487cd91ce75894712aca5fffbed91d6938107669f158e3c004913fdbbec2" style="font-size: 13px; font-weight: normal;" target="_blank" title=""><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><img alt="Instagram" height="60" src="http://image.email.racq.com.au/lib/fe9313707560017b73/m/4/cn-ico-img-igrm.gif" style="display: block;" title="See us on Instagram" width="50"></font></a></font></font></b></td></tr></table> <table align="center" bgcolor="#edeef0" border="0" cellpadding="0" cellspacing="0" style="margin: 0px; padding: 0px; font-family: arial,helvetica,sans-serif; font-weight: 400; border-collapse: collapse;"> <tr class="mobile" style="margin: 0px; padding: 0px; font-family: Arial,Helvetica,sans-serif; font-weight: bold;"> <td class="bottom-padding mobile" style="margin: 0px; padding: 0px 0px 20px; font-family: Arial, Helvetica, sans-serif; border-collapse: collapse;"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-weight: normal;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=7e4d307ce5a6f7fdd10036d24485b31edcddf6dc03cbc9a865941fce938ff2229a2cc3f27fba7910f341337e60ba64ad6ecd23774348a275" style="color:#4B5869;text-decoration:none;margin: 0px; padding: 0px;" target="_blank" title="Click to read more about RACQ">About</a> <span class="spacer" style="width: 20px; display: inline-block;"> </span></span></font></b></td><td class="bottom-padding mobile" style="margin: 0px; padding: 0px 0px 20px; font-family: Arial, Helvetica, sans-serif; font-weight: bold; border-collapse: collapse;"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-weight: normal;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cda4598668a108cad4cf423c7a332a9840d1f59ab10549809f4adfa521eb2a72fa58e5b1376c697e6a39a6b4205cb7693" style="color:#4B5869;text-decoration:none;margin: 0px; padding: 0px;" target="_blank" title="Click to contact us today">Contact</a> <span class="spacer" style="width: 20px; display: inline-block;"> </span></span></font></b></td><td class="bottom-padding mobile" style="margin: 0px; padding: 0px 0px 20px; font-family: Arial, Helvetica, sans-serif; font-weight: bold; border-collapse: collapse;"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-weight: normal;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c571d605144dc0b3081cc733f484a3ea56c02729e985ad136f9e98f6688b27f187b6bf91880a086ec49650035248ebaf6" style="color:#4B5869;text-decoration:none;margin: 0px; padding: 0px;" target="_blank" title="Click to read our Privacy Statement">Privacy</a> <span class="spacer" style="width: 20px; display: inline-block;"> </span></span></font></b></td><td class="bottom-padding mobile" style="margin: 0px; padding: 0px 0px 20px; font-family: Arial, Helvetica, sans-serif; font-weight: bold; border-collapse: collapse;"> <b><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-weight: normal;"><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cfe465b8f42e199c0928b4835ce60971738f40bce8754b9f2fcfd93d3a0f9e3b84093de5917adbc822c6fb8b8ca6a25d8" style="color:#4B5869;text-decoration:none;margin: 0px; padding: 0px;" target="_blank" title="Click for membership login">Login</a> <span class="spacer" style="width: 20px; display: inline-block;"> </span></span></font></b></td></tr></table></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><style type="text/css"> / MOBILE STYLES - Media All / @media all { a:hover { color: #0475fb !important; } a:visited { color: #4b5869 !important; } }</style><table bgcolor="#edeef0" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" class="contentspad" style="padding: 5px 10px;" valign="top"> <p style="margin: 0px; padding: 0px 0px 5px; line-height: 18px;"> <font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-size: 13px;">You are currently subscribed to Club News and the digital Road Ahead.  </span></font><br> <br> <font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-size: 13px;">To unsubscribe from Club News, <b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c9c75f586c781a84c93e36f384fb9a6899a0142766987d02fc9ab9cbb6ab7b6c6bab6d223a273ece5102a06efd217c8a4" style="color:#4b5869;text-decoration:none;" title="click here">click here</a></b>. To unsubscribe from the digital Road ahead, <b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c7c20f65b25476dfdaf72fb71767220e0bac9ff0b07196b883f25710152e1f5876b4063889c3ae3ffd2595457a13a6339" style="color:#4b5869;text-decoration:none;" title="click here">click here</a></b></span></font><span style="color: rgb(51, 51, 51); font-family: sans-serif, Arial, Verdana, "Trebuchet MS"; font-weight: 400; font-size: 13px;">.</span></p></td></tr></table></td></tr></table> </td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><style type="text/css"> / MOBILE STYLES - Media All / @media all { a:hover { color: #0475fb !important; } a:visited { color: #4b5869 !important; } }</style><table bgcolor="#edeef0" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" class="contentspad" style="padding: 5px 10px;" valign="top"> <p style="margin: 0px; padding: 0px 0px 5px; line-height: 18px;"> <font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-size: 13px;">^Competition terms and conditions apply. Entries are open until 5pm, 19 July 2020. Voting is then open from 27 July - 9 August 2020. Visit <b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70cbf91c97de822652369c1a456eac3b58e507a3e4adc42bcaf9f88b32b714bf8bdf5ca28a6372d65339f41471dc59fbd84" style="color:#4b5869;text-decoration:none;" title="racq.com/competition">racq.com/mustdoqld</a></b> for more details.<br> <br> Retail partners, offers and discounts may change at any time without notice. Visit<b> <a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c84cfb3b0f29946b271bbc305a7c6042ddc2ebfbef224e5d0d197eee0d23c4a56823f734ec0968a5c77eafcb549ce586a" style="color:#4b5869;text-decoration:none;" title="racq.com/discounts">racq.com/discounts</a></b></span><font color="#333333" face="sans-serif, Arial, Verdana, Trebuchet MS"><span style="font-size: 13px;"> or click on the links above for the conditions, limits and exclusions for each offer.<br> <br> ~Terms and conditions apply. Visit <b><a data-linkto="https://" href="http://click.email.racq.com.au/?qs=ef95d43b3f24a70c1e1ca3c342413ece806c07f444b14645ba64ce7bc4f8732af1b369c0da59d46b836869c62ca4202f7eac7b9527182168" style="color:#4b5869;text-decoration:none;" title="racq.com/foundation">racq.com/foundation</a></b> for more details.<br> <br> +The information has been prepared for general information purposes. Any advice is general advice and does not take into account any person’s particular investment objectives, financial situation or needs. Before acting on anything based on this advice you should consider its appropriateness to you, having regard to your objectives, financial situations and needs.</span></font></font></p></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="background-color: #DBDBDB; min-width: 100%; " class="stylingblock-content-wrapper"><tr><td style="padding: 0px; " class="stylingblock-content-wrapper camarker-inner"><style type="text/css"> /* MOBILE STYLES - Media All */ @media all { a:hover { color: #0475fb !important; } a:visited { color: #4b5869 !important; } }</style><table bgcolor="#edeef0" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" class="contentspad" style="padding: 5px 10px;" valign="top"> <p style="margin: 0px; padding: 0px 0px 5px; line-height: 18px; font-family: Arial, Helvetica, sans-serif; font-weight: 400;"> <span style="font-size: 13px; font-family: sans-serif, Arial, Verdana, "Trebuchet MS"; color: rgb(51, 51, 51);"><span style="color:#333333;"><font face="sans-serif, Arial, Verdana, Trebuchet MS"><font face="sans-serif, Arial, Verdana, Trebuchet MS"><font face="sans-serif, Arial, Verdana, Trebuchet MS">This email was sent by: RACQ, 2649 Logan Road Eight Mile Plains QLD, 4113, Australia</font></font></font></span></span></p></td></tr></table></td></tr></table></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr> <td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr> <td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr><tr><td valign="top" align="left"></td></tr></table></td></tr></table></custom></body></html> --4Q6VtzO5B4DW=_?:--

| ver. 1.4 | Github | . | PHP 7.4.33 | Generation time: 0 | proxy | phpinfo | Settings