File manager - Edit - /home/aussies6/mail/seafoodwarehouse.com.au/ianhamilton/.spam/cur/1590712460.M526242P1990.au6.voltdns.com,S=116068,W=117599:2,a
Back
Return-Path: <bounce-529_HTML-1158884364-3059831-1461421-306@bounce.info.livenation.com.au> Delivered-To: ianhamilton+spam@seafoodwarehouse.com.au Received: from au6.voltdns.com by au6.voltdns.com with LMTP id cLg6H4xY0F7GBwAATr7HEg (envelope-from <bounce-529_HTML-1158884364-3059831-1461421-306@bounce.info.livenation.com.au>) for <ianhamilton+spam@seafoodwarehouse.com.au>; Fri, 29 May 2020 10:34:20 +1000 Return-path: <bounce-529_HTML-1158884364-3059831-1461421-306@bounce.info.livenation.com.au> Envelope-to: ianhamilton@seafoodwarehouse.com.au Delivery-date: Fri, 29 May 2020 10:34:20 +1000 Received: from nsstlmta24p.bpe.bigpond.com ([203.38.21.24]:44128) by au6.voltdns.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384 (Exim 4.93) (envelope-from <bounce-529_HTML-1158884364-3059831-1461421-306@bounce.info.livenation.com.au>) id 1jeSyW-0000Zb-Mp for ianhamilton@seafoodwarehouse.com.au; Fri, 29 May 2020 10:34:20 +1000 Received: from extmail.bigpond.com ([10.10.24.4]) by nsstlfep24p-svc.bpe.nexus.telstra.com.au with ESMTP id <20200529003334.SJPC20622.nsstlfep24p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com> for <aussfdservices@bigpond.com>; Fri, 29 May 2020 10:33:34 +1000 X-RG-Spam: Unknown X-RG-VS-CLASS: commercial-misc X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeduhedruddvjedgfeduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecundfotefknffkpffiucdludejmdenucfjughrpefhvffufffjggejkfgtsegrtderredttdejnecuhfhrohhmpedfnfhivhgvucfprghtihhonhcutehushhtrhgrlhhirgdfuceovghmrghilhesihhnfhhordhlihhvvghnrghtihhonhdrtghomhdrrghuqeenucggtffrrghtthgvrhhnpeejffeltedtvefffeegveelgeehtdehveettdelheefteehudeigfefkeevvedufeenucffohhmrghinheplhhivhgvnhgrthhiohhnrdgtohhmrdgruhenucfkphepieekrddvfedvrddvtdeirdduudejnecuvehluhhsthgvrhfuihiivgephedvkeenucfrrghrrghmpehhvghlohepmhhtrgdrihhnfhhordhlihhvvghnrghtihhonhdrtghomhdrrghupdhinhgvthepieekrddvfedvrddvtdeirdduudejpdhmrghilhhfrhhomhepoegsohhunhgtvgdqhedvlegpjffvoffnqdduudehkeekkeegfeeigedqfedtheelkeefuddqudegiedugedvuddqfedtieessghouhhntggvrdhinhhfohdrlhhivhgvnhgrthhiohhnrdgtohhmrdgruhequceuqfffjgepkeeukffvoffkoffgpdhrtghpthhtohepoegruhhsshhfughsvghrvhhitggvshessghighhpohhnugdrtghomhequcfqtfevrffvpehrfhgtkedvvdenrghu shhsfhgushgvrhhvihgtvghssegsihhgphhonhgurdgtohhm X-RazorGate-Vade-Verdict: clean 17 X-RazorGate-Vade-Classification: commercial-misc Received: from mta.info.livenation.com.au (68.232.206.117) by extmail.bigpond.com (5.8.420) id 5E83D99C0FF8CC5C for aussfdservices@bigpond.com; Fri, 29 May 2020 10:33:34 +1000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=200608; d=info.livenation.com.au; h=From:To:Subject:Date:List-Unsubscribe:MIME-Version:List-ID:X-CSA-Complaints: Message-ID:Content-Type; i=email@info.livenation.com.au; bh=tMqkXWRM58NpXAEr4lFZZWD47/3hieonmrinBWdc7Og=; b=u257tvBlArFdAECOq3Q65411oww9NkAk9VTRneEEFINXX5i5BWuO0hteM9YvWIhsR4JocvVhd9M4 puCEza4eS5MO5C91juqdX+amo/YvD9TDTuICBZQrsmPfoHpD6aX+Xp7+W6bNt8nCAamOG63CB+G6 x5hlbtsyliDX0R7q2yk= Received: by mta.info.livenation.com.au id hq1c5s2fmd4d for <aussfdservices@bigpond.com>; Thu, 28 May 2020 23:33:07 +0000 (envelope-from <bounce-529_HTML-1158884364-3059831-1461421-306@bounce.info.livenation.com.au>) From: "Live Nation Australia" <email@info.livenation.com.au> To: <aussfdservices@bigpond.com> Date: Thu, 28 May 2020 17:33:07 -0600 List-Unsubscribe: <mailto:leave-fd4b11727c0b5c392848-fdef1571706c0c7571177671-fe921770706d0c7e74-fe9c15747365007f74-ff66177073@leave.info.livenation.com.au> MIME-Version: 1.0 List-ID: <1063224.xt.local> X-CSA-Complaints: whitelist-complaints@eco.de X-SFMC-Stack: 4 x-job: 1461421_3059831 Message-ID: <ef689e92-3a4d-4dc6-b64c-f0156fe53bfb@las1s04mta822.xt.local> Content-Type: multipart/alternative; boundary="5I0TDzOslYIZ=_?:" X-Spam-Status: Yes, score=5.5 X-Spam-Score: 55 X-Spam-Bar: +++++ X-Spam-Report: Spam detection software, running on the system "au6.voltdns.com", has identified this incoming email as possible spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Live Nation http://click.info.livenation.com.au/?qs=78db696f6deb1a730a42dc9c852d16432a2c9ca05ba75713cf4008da29a8e09771f805010c13d329fd7f2d8c0fbbf5dc07faf4046a577742 http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e6d964fcd28162de392e00db76317f1d3968643c983f8bde294b1d87930e3b1907a8e9845ccb54e7884e119157ca71392 Content analysis details: (5.5 points, 5.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: livenation.co.uk] -0.7 RCVD_IN_DNSWL_LOW RBL: Sender listed at https://www.dnswl.org/, low trust [203.38.21.24 listed in list.dnswl.org] 4.0 SPF_FAIL SPF: sender does not match SPF record (fail) [SPF failed: Please see http://www.openspf.org/Why?s=mfrom;id=bounce-529_html-1158884364-3059831-1461421-306%40bounce.info.livenation.com.au;ip=203.38.21.24;r=au6.voltdns.com] 0.0 HTML_MESSAGE BODY: HTML included in message 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature -0.1 DKIM_VALID_AU Message has a valid DKIM or DK signature from author's domain 1.0 SCC_5_SHORT_WORD_LINES 5 lines with many short words 1.0 SCC_10_SHORT_WORD_LINES 10 lines with many short words 0.2 KAM_LOTSOFHASH Emails with lots of hash-like gibberish X-Spam-Flag: YES Subject: ***SPAM*** =?UTF-8?B?TmV3IG11c2ljIGluc2lkZSDwn5Sl?= This is a multi-part message in MIME format. --5I0TDzOslYIZ=_?: Content-Type: text/plain; charset="utf-8" Content-Transfer-Encoding: 8bit Live Nation http://click.info.livenation.com.au/?qs=78db696f6deb1a730a42dc9c852d16432a2c9ca05ba75713cf4008da29a8e09771f805010c13d329fd7f2d8c0fbbf5dc07faf4046a577742 http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e6d964fcd28162de392e00db76317f1d3968643c983f8bde294b1d87930e3b1907a8e9845ccb54e7884e119157ca71392 Photo: Ariana Grande | GettyImages TRENDING LIVE FROM HOME We can't stop listening to http://click.info.livenation.com.au/?qs=5a0049e322a2761ac25af4a7cc7561a6d5e47bf834c11ee1d0923e40a7ce757e9439543e3e2fe298693a5df83729e485ace068deba804bc4 Rain On Me by Lady Gaga and Ariana Grande off Gaga's new album, CHROMATICA - which was released today! Join Kiwi superstar BENEE as she takes you on an ASMR adventure while chatting about her track, Blu. Finally, tune into a mix of content from LIVE FROM HOME: AROUND THE WORLD, including an insane DJ set from the top of the alps in France, and the best bits from BBC Radio 1's Big Weekend, featuring RITA ORA, BIFFY CLYRO and the JONAS BROTHERS. http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e6d964fcd28162de392e00db76317f1d3968643c983f8bde294b1d87930e3b1907a8e9845ccb54e7884e119157ca71392 SEE MORE http://click.info.livenation.com.au/?qs=5a0049e322a2761ac25af4a7cc7561a6d5e47bf834c11ee1d0923e40a7ce757e9439543e3e2fe298693a5df83729e485ace068deba804bc4 — NEW VIDEO — RAIN ON ME http://click.info.livenation.com.au/?qs=5a0049e322a2761a18f3d8bd4916bae32640625c933e37d78b5ef6d30256a875e71807b4291c421e3a762be2db3c0dfa24298d0a0ee84f42 — CHEF NATION — WILLIE GOMEZ http://click.info.livenation.com.au/?qs=5a0049e322a2761ac25af4a7cc7561a6d5e47bf834c11ee1d0923e40a7ce757e9439543e3e2fe298693a5df83729e485ace068deba804bc4 WATCH HERE http://click.info.livenation.com.au/?qs=5a0049e322a2761a18f3d8bd4916bae32640625c933e37d78b5ef6d30256a875e71807b4291c421e3a762be2db3c0dfa24298d0a0ee84f42 WATCH HERE http://click.info.livenation.com.au/?qs=5a0049e322a2761adc93167ce25a2addd95edc43d86f7ea904b832ae6a731de5f621c07c13068f2685073c96b227027fde055bb2139f61e4 Photo: Twenty One Pilots | Steven Cook — LIVE — TWENTY ONE PILOTS http://click.info.livenation.com.au/?qs=5a0049e322a2761a3b87753fa5d42113639e3214faac83a5f6a7dded537d2f300bdab99789014d50abe4b0c45bbf4ec5aa50f2da790784cf Photo: Benee | Jess Gleeson — BENEEFIED — ASMR WITH BENEE http://click.info.livenation.com.au/?qs=5a0049e322a2761adc93167ce25a2addd95edc43d86f7ea904b832ae6a731de5f621c07c13068f2685073c96b227027fde055bb2139f61e4 LISTEN HERE http://click.info.livenation.com.au/?qs=5a0049e322a2761a3b87753fa5d42113639e3214faac83a5f6a7dded537d2f300bdab99789014d50abe4b0c45bbf4ec5aa50f2da790784cf WATCH HERE ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ AROUND THE WORLD http://click.info.livenation.com.au/?qs=5a0049e322a2761a984312794bfaeb7f0cb2dbcc2f2a929cb33298d8f1a3f70a2e46c230d339a4815cc5ac745e258a3d073cdf5c931398c7 FRANCE THE BLAZE | LIVE FROM THE ALPS http://click.info.livenation.com.au/?qs=5a0049e322a2761a984312794bfaeb7f0cb2dbcc2f2a929cb33298d8f1a3f70a2e46c230d339a4815cc5ac745e258a3d073cdf5c931398c7 http://click.info.livenation.com.au/?qs=5a0049e322a2761a0060c07110645b66b870090d5b83606002a43cc40f772604072e1defcc62818b19e658f9267e16a6d794acf4fbc075da CANADA BUDWEISER STAGE AT HOME http://click.info.livenation.com.au/?qs=5a0049e322a2761a0060c07110645b66b870090d5b83606002a43cc40f772604072e1defcc62818b19e658f9267e16a6d794acf4fbc075da http://click.info.livenation.com.au/?qs=5a0049e322a2761a8d8a17ebb0f5295e97d8b62690619a1608f182c595d81f32a46fd6f6647beb520e48eef810f0acb5e22637a0257f02a6 UK BBC RADIO 1 | BIG WEEKEND hon http://click.info.livenation.com.au/?qs=5a0049e322a2761a8d8a17ebb0f5295e97d8b62690619a1608f182c595d81f32a46fd6f6647beb520e48eef810f0acb5e22637a0257f02a6 http://click.info.livenation.com.au/?qs=5a0049e322a2761ad00f45665019629af88dd407c7c47fa6f6b48ecffa618e7bebe75339b9a451a44a8d7ebf6d6b456770af9b9566570de2 SOUTH AFRICA AFRICA DAY BENEFIT CONCERT http://click.info.livenation.com.au/?qs=5a0049e322a2761ad00f45665019629af88dd407c7c47fa6f6b48ecffa618e7bebe75339b9a451a44a8d7ebf6d6b456770af9b9566570de2 http://click.info.livenation.com.au/?qs=5a0049e322a2761af931ac9bed54aaa56ef9d4a13960c28e31e44924dea80a60734510b8c559ad5c5697c24c0de8c715d8fdae89a3337eca rad SWEDEN FELIX SANDMAN | LIVE STREAM http://click.info.livenation.com.au/?qs=5a0049e322a2761af931ac9bed54aaa56ef9d4a13960c28e31e44924dea80a60734510b8c559ad5c5697c24c0de8c715d8fdae89a3337eca http://click.info.livenation.com.au/?qs=5a0049e322a2761a8be93fb0c94ff40739de94fecc9f32b2860b0589d2f15708d52c1ba453e1e0b48c405f636e611da383287b938afb6403 MY LIVE NATION PRESALES Register with Live Nation to be amongst the first to buy Presale tickets to the hottest shows in town before the general public. Plus receive the latest events and special offers straight to your inbox. http://click.info.livenation.com.au/?qs=78db696f6deb1a73427728e0be4d23e8b10cd9a7120ddc65f39ff46be3342444515ee9bbad3514e139cd3cc5f2dc7d264059453732797f24 REGISTER FOLLOW US http://click.info.livenation.com.au/?qs=78db696f6deb1a737bc79df743d703531d609e1c535b79cfceb4a11e0b4d664940a2f9c59ad4d3a03f98b0cbf02f3963bc742f2fa4b0c225 http://click.info.livenation.com.au/?qs=78db696f6deb1a73dc26c4cafdb2cbe4ffbf2ee9c62949ce2907b9a6ee50a00e7239f77a11ffcdd3dbd82f443d32140ff88f644b74d43e92 http://click.info.livenation.com.au/?qs=ab8ab4ba066a41499d38789537a787e74b3b0f9508a50da7750f75f3e17666e30097b2febbe66600417addf698b74303e952bca855ce317c http://click.info.livenation.com.au/?qs=78db696f6deb1a7359c2ea77f2f6bcc6d2377d1833dea25b0b4010fc94aa2af36b5adc97f070093ac6db080d90ba7226390a4f765efbfb65 http://click.info.livenation.com.au/?qs=78db696f6deb1a7311adb40e10fd6d0f79184df2833664d3aec8a38e4f838183d1c6838726cfe71fe486a1b6361c8e5d8b6a1d73c7307988 http://click.info.livenation.com.au/?qs=78db696f6deb1a730a42dc9c852d16432a2c9ca05ba75713cf4008da29a8e09771f805010c13d329fd7f2d8c0fbbf5dc07faf4046a577742 Concerts & Events | http://click.info.livenation.com.au/?qs=78db696f6deb1a735f665f5680afb9731996b8326e3ce6f5e3211469476e499334ee065e4d4523e72a0628670dbdb503770b8e7cbd4cb1cd Festivals | http://click.info.livenation.com.au/?qs=78db696f6deb1a7304ee2a838ea786859899eb5d0d1b1c0e2ad6efa4c0133f4bdff31fc74e49ce05db4a8375b0888f17c937aa390aed0217 VIP Tickets http://click.info.livenation.com.au/?qs=78db696f6deb1a73c00dc8737578de38882ade9c81ae25ad8a15541d892753beeb4a2cae53fad0c747d3407595794464bfa795ee02d759b0 Privacy Policy http://click.info.livenation.com.au/?qs=ab8ab4ba066a4149b71e826a79035a96810f12c0785509bc746a11f1f954131818331fe2728758e1aca986f5cc7780183278f4dc82251a9c Terms & Conditions http://click.info.livenation.com.au/?qs=ab8ab4ba066a4149b3eef516063720f6089cbd1fe9cdee597d590f9a4be94aaff1e885bea68278a0e8e75598aaaceffb01edf97a05dc81b5 Contact Us http://click.info.livenation.com.au/?qs=ab8ab4ba066a4149ed2b63d97261a9e04b42ea94af282bd30e58d5d552ca1c3fb3dae4463d1bf535a40cef1ce543952cdcb7bc30d95d4427 Unsubscribe (c) 2020 Live Nation Australasia Pty Ltd. Live Nation ® is a registered trademark of Live Nation Entertainment. If you wish us to update our records to exclude you from receiving future emails regarding presales, special offers and advance notice of forthcoming Live Nation events, log on and update your preferences. Please do not reply to this email. Our emails contain technologies to track how you interact with them. We do this to help improve our emails and for online behavioural advertising purposes. For further information, including how to disable such technologies, please see our privacy and cookies policies. --5I0TDzOslYIZ=_?: Content-Type: text/html; charset="utf-8" Content-Transfer-Encoding: 8bit <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office"> <head> <!--[if gte mso 9]><xml> <o:OfficeDocumentSettings> <o:AllowPNG/> <o:PixelsPerInch>96</o:PixelsPerInch> </o:OfficeDocumentSettings> </xml><![endif]--> <title>Live Nation</title> <meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> <meta http-equiv="X-UA-Compatible" content="IE=edge" /> <meta name="viewport" content="width=device-width, initial-scale=1.0 " /> <meta name="format-detection" content="telephone=no"/> <style type="text/css"> @font-face { font-family: "proxima-nova"; src: url("https://use.typekit.net/af/949f99/00000000000000003b9b3068/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff2"), url("https://use.typekit.net/af/949f99/00000000000000003b9b3068/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff"), url("https://use.typekit.net/af/949f99/00000000000000003b9b3068/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("opentype"); font-style: normal; font-weight: 700; } @font-face { font-family: "proxima-nova"; src: url("https://use.typekit.net/af/4c4052/00000000000000003b9b3069/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff2"), url("https://use.typekit.net/af/4c4052/00000000000000003b9b3069/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff"), url("https://use.typekit.net/af/4c4052/00000000000000003b9b3069/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("opentype"); font-style: italic; font-weight: 700; } @font-face { font-family: "proxima-nova"; src: url("https://use.typekit.net/af/705e94/00000000000000003b9b3062/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff2"), url("https://use.typekit.net/af/705e94/00000000000000003b9b3062/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff"), url("https://use.typekit.net/af/705e94/00000000000000003b9b3062/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("opentype"); font-style: normal; font-weight: 400; } @font-face { font-family: "proxima-nova"; src: url("https://use.typekit.net/af/5c70f2/00000000000000003b9b3063/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff2"), url("https://use.typekit.net/af/5c70f2/00000000000000003b9b3063/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff"), url("https://use.typekit.net/af/5c70f2/00000000000000003b9b3063/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("opentype"); font-style: italic; font-weight: 400; } @font-face { font-family: "proxima-nova-condensed"; src: url("https://use.typekit.net/af/0ff5e1/00000000000000003b9b3078/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff2"), url("https://use.typekit.net/af/0ff5e1/00000000000000003b9b3078/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff"), url("https://use.typekit.net/af/0ff5e1/00000000000000003b9b3078/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("opentype"); font-style: normal; font-weight: 700; } @font-face { font-family: "proxima-nova-condensed"; src: url("https://use.typekit.net/af/519896/00000000000000003b9b3079/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff2"), url("https://use.typekit.net/af/519896/00000000000000003b9b3079/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff"), url("https://use.typekit.net/af/519896/00000000000000003b9b3079/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("opentype"); font-style: italic; font-weight: 700; } @font-face { font-family: "proxima-nova-condensed"; src: url("https://use.typekit.net/af/8e2bbd/00000000000000003b9b3072/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff2"), url("https://use.typekit.net/af/8e2bbd/00000000000000003b9b3072/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff"), url("https://use.typekit.net/af/8e2bbd/00000000000000003b9b3072/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("opentype"); font-style: normal; font-weight: 400; } @font-face { font-family: "proxima-nova-condensed"; src: url("https://use.typekit.net/af/5364bc/00000000000000003b9b3073/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff2"), url("https://use.typekit.net/af/5364bc/00000000000000003b9b3073/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff"), url("https://use.typekit.net/af/5364bc/00000000000000003b9b3073/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("opentype"); font-style: italic; font-weight: 400; } @font-face { font-family: "proxima-nova-extra-condensed"; src: url("https://use.typekit.net/af/4a329e/00000000000000003b9b3089/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff2"), url("https://use.typekit.net/af/4a329e/00000000000000003b9b3089/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("woff"), url("https://use.typekit.net/af/4a329e/00000000000000003b9b3089/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i7&v=3") format("opentype"); font-style: italic; font-weight: 700; } @font-face { font-family: "proxima-nova-extra-condensed"; src: url("https://use.typekit.net/af/7b18df/00000000000000003b9b3088/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff2"), url("https://use.typekit.net/af/7b18df/00000000000000003b9b3088/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("woff"), url("https://use.typekit.net/af/7b18df/00000000000000003b9b3088/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n7&v=3") format("opentype"); font-style: normal; font-weight: 700; } @font-face { font-family: "proxima-nova-extra-condensed"; src: url("https://use.typekit.net/af/bcf2f4/00000000000000003b9b3083/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff2"), url("https://use.typekit.net/af/bcf2f4/00000000000000003b9b3083/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("woff"), url("https://use.typekit.net/af/bcf2f4/00000000000000003b9b3083/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=i4&v=3") format("opentype"); font-style: italic; font-weight: 400; } @font-face { font-family: "proxima-nova-extra-condensed"; src: url("https://use.typekit.net/af/0dfb3d/00000000000000003b9b3082/27/l?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff2"), url("https://use.typekit.net/af/0dfb3d/00000000000000003b9b3082/27/d?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("woff"), url("https://use.typekit.net/af/0dfb3d/00000000000000003b9b3082/27/a?primer=7cdcb44be4a7db8877ffa5c0007b8dd865b3bbc383831fe2ea177f62257a9191&fvd=n4&v=3") format("opentype"); font-style: normal; font-weight: 400; } body { margin: 0; padding: 0; -webkit-text-size-adjust: 100% !important; -ms-text-size-adjust: 100% !important; -webkit-font-smoothing: antialiased !important; } img { border: 0 !important; outline: none !important; } p { Margin: 0px !important; Padding: 0px !important; } table { border-collapse: collapse; mso-table-lspace: 0px; mso-table-rspace: 0px; } td, a, span { border-collapse: collapse; mso-line-height-rule: exactly; } .ExternalClass * { line-height: 100%; } .em_defaultlink a { color: inherit; text-decoration: none; } .em_g_img + div { display: none; } center table { width: 100% !important; } @media only screen and (min-width:481px) and (max-width:649px) { .em_main_table { width: 480px !important; } .em_wrapper { width: 100% !important; } .em_hide { display: none !important; } .em_full_img { width: 100% !important; height: auto !important; } .em_full_img img { width: 100% !important; height: auto !important; } .em_full_img1 { width: 100% !important; height: 116px !important; } .em_full_img1 img { width: 100% !important; height: 116px !important; } .em_full_img1-spacer { width: 100% !important; height: 1px !important; } .em_full_img1-spacer img { width: 100% !important; height: 1px !important; } .em_side10 { width: 10px !important; } .em_aside10 { padding: 0px 10px !important; } .em_aside15 { padding: 0px 15px !important; } .em_pbottom { padding-bottom: 20px !important; } .em_p5 { padding: 15px 10px 5px 10px !important; } /* Padding Left Right Bottom */ .em_p10 { padding: 15px 10px !important; } /* Padding Left Right Bottom */ .em_h20 { height: 20px !important; font-size: 1px!important; line-height: 1px!important; } .em_h30 { height: 30px !important; } .em_hauto { height: auto !important; background-size: cover !important; } /* update the N number as per width */ .em_clear { clear: both !important; width: 100% !important; display: block !important; } .em_font_11 { font-size: 15px !important; line-height: 18px !important; } .em_wi160 { width: 220px !important; height: auto !important; } .em_wi160 img { width: 220px !important; height: auto !important; } /* update the N number as per width */ .em_wi220 { width: 300px !important; height: auto !important; } .em_wi220 img { width: 300px !important; height: auto !important; } /* update the N number as per width */ .em_p40 { padding: 40px 10px !important; } .em_font_30 { font-size: 50px !important; line-height: 60px !important; } .em_font_301 { font-size: 40px !important; line-height: 35px !important; font-weight: 800; } .em_font_15 { font-size: 30px !important; line-height: 35px !important; } .em_w141 { width: 40% !important; } .em_wimg { height: auto !important; width: 225px !important; } .em_font12 { font-size: 12px !important; line-height: 15px !important; } .em_btnpad { padding: 0px 74px !important; } .em_btnpad2 { padding: 0px 58px !important; } .em_pbottom10 { padding-bottom: 10px !important; } .em_w300 { max-width: 460px !important; } .em_h33btn2 { height: 30px !important; line-height: 30px !important; font-size: 10px !important; } .em_h33btn3 { height: 35px !important; line-height: 35px !important; font-size: 18px !important; } .em_font_17 { font-size: 17px !important; line-height: 23px !important; } .em_h15 { height: 15px !important; line-height: 0px !important; font-size: 0px !important; } .em_h151 { height: 10px !important; line-height: 0px !important; font-size: 0px !important; } .em_w40 { width: 90px !important; height: auto !important; } .em_w20 { width: 30px !important; height: auto !important; vertical-align: middle !important } .em_h100 { height: 100px !important; } .em_w35 { width: 45px !important; height: auto !important; } .em_h18 { height: 20px !important; font-size: 1px!important; line-height: 1px!important; } .em_h42 { height: 42px !important; } .em_h421 { height: 42px !important; } .em_font11 { font-size: 15px !important; line-height: 18px !important; } .em_font111 { font-size: 15px !important; line-height: 18px !important; } .em_font_15_4 { font-size: 23px !important; line-height: 28px !important; } .em_h103{ height:155px !important; } } @media screen and (max-width: 480px) { .em_main_table { width: 100% !important; } .em_wrapper { width: 100% !important; } .em_hide { display: none !important; } .em_full_img { width: 100% !important; height: auto !important; } .em_full_img img { width: 100% !important; height: auto !important; } .em_side10 { width: 10px !important; } .em_aside10 { padding: 0px 10px !important; } .em_aside15 { padding: 0px 15px !important; } .em_pbottom { padding-bottom: 20px !important; } .em_p5 { padding: 15px 10px 5px 10px !important; } /* Padding Left Right Bottom */ .em_p10 { padding: 15px 10px !important; } .em_p40 { padding: 40px 10px !important; } /* Padding Left Right Bottom */ .em_h20 { height: 20px !important; font-size: 1px!important; line-height: 1px!important; } .em_full_img1 { width: 100% !important; height: auto !important; } .em_full_img1 img { width: 100% !important; height: auto !important; } .em_full_img1-spacer { width: 100% !important; height: 1 !important; } .em_full_img1-spacer img { width: 100% !important; height: 1 !important; } .em_h18 { height: 20px !important; font-size: 1px!important; line-height: 1px!important; } .em_h30 { height: 30px !important; } .em_h15 { height: 15px !important; line-height: 0px !important; font-size: 0px !important; } .em_h151 { height: 5px !important; line-height: 0px !important; font-size: 0px !important; } .em_h152 { height: 10px !important; line-height: 0px !important; font-size: 0px !important; } .em_hauto { height: auto !important; background-size: cover !important; } .em_font_11 { font-size: 11px !important; line-height: 13px !important; } /* update the N number as per font-size */ .em_font_30 { font-size: 32px !important; line-height: 41px !important; } .em_font_301 { font-size: 28px !important; line-height: 35px !important; font-weight: 800; } .em_font_15 { font-size: 20px !important; line-height: 25px !important; } .em_font_17 { font-size: 17px !important; line-height: 23px !important; } .em_font_15_4 { font-size: 14px !important; line-height: 20px !important; } .em_font_15_2 { font-size: 16px !important; line-height: 22px !important; } .em_font_15_3 { font-size: 13px !important; line-height: 15px !important; } .em_wi160 { width: 160px !important; height: auto !important; } .em_wi160 img { width: 160px !important; height: auto !important; } .em_wi220 { width: 220px !important; height: auto !important; } .em_wi220 img { width: 220px !important; height: auto !important; } .em_clear { clear: both !important; width: 100% !important; display: block !important; } u + .em_body .em_full_wrap { width: 100% !important; width: 100vw !important; } .em_h245 { height: 240px !important; } .em_h33btn { height: 35px !important; line-height: 35px !important; font-size: 17px !important; } .em_h33btn2 { height: 30px !important; line-height: 30px !important; font-size: 10px !important; } .em_h33btn3 { height: 45px !important; line-height: 45px !important; font-size: 18px !important; } .em_btnwidth { max-width: 245px !important; } .em_w141 { width: 40% !important; } .em_wimg { height: auto !important; width: 145px !important; } .em_font12 { font-size: 12px !important; line-height: 15px !important; } .em_font9 { font-size: 9px !important; line-height: 15px !important; } .em_font11 { font-size: 11px !important; line-height: 13px !important; } .em_font111 { font-size: 14px !important; line-height: 20px !important; } .em_btnpad { padding: 0px 74px !important; } .em_btnpad2 { padding: 0px 58px !important; } .em_pbottom10 { padding-bottom: 10px !important; } .em_w300 { max-width: 300px !important; } .em_w40 { width: 60px !important; height: auto !important; } .em_w20 { width: 20px !important; height: auto !important; } .em_h100 { height: 100px !important; } .em_h42 { height: 35px !important; } .em_side20 { width: 20px !important; } .em_h1 { height: 1px !important; line-height: 0px !important; font-size: 0px !important; } .em_w35 { width: 35px !important; height: auto !important; } .em_h103{ height:103px !important; } } </style> </head> <!--[if mso]> <style type="text/css"> body, table, td {font-family: Arial, sans-serif !important; } </style> <![endif]--> <body bgcolor="#f0f0f0" class="em_body" style="margin:0px auto; padding:0px;"><style type="text/css"> div.preheader { display: none !important; } </style> <div class="preheader" style="font-size: 1px; display: none !important;">Lady Gaga and Ari team up for track 'Rain On Me' | Stream the best of Radio 1's Big Weekend!</div> <!-- == C1-Header Global Section == --> <table width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td valign="top" align="center"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><style type="text/css"> #_eoa_div, #_eoa_img { display:none; } @media print{ #_eoa_div { background-image: url('https://JXoi8wt64b.eoapxl.com/JXoi8wt64b/@EMAIL@/P'); } } div.OutlookMessageHeader, table.moz-email-headers-table, blockquote #_eoa_div, #mailContainerBody #_eoa_div { background-image:url('https://JXoi8wt64b.eoapxl.com/JXoi8wt64b/@EMAIL@/F') }</style><div id="_eoa_div"> </div><img alt="" border="0" height="1" id="_eoa_img" src="https://JXoi8wt64b.eoapxl.com/JXoi8wt64b/@EMAIL@" style="height:1px !important;width:1px !important;border-width:0 !important;margin-top:0 !important;margin-bottom:0 !important;margin-right:0 !important;margin-left:0 !important;padding-top:0 !important;padding-bottom:0 !important;padding-right:0 !important;padding-left:0 !important;display:block;" title="" width="1"><table align="center" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" valign="top"> <table bgcolor="#e21836" border="0" cellpadding="0" cellspacing="0" class="em_full_wrap" width="100%"> <tr> <td align="center" valign="top"> <table align="center" bgcolor="#e21836" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td align="center" class="em_p10" style="padding: 36px 20px;" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e8739d1b96b89af64b67b52588dda79d47950bdbcf8b9cfd4370488b6f2b04d9deeadfdb5903508944da021900a17103cd5c8c573e130bb5e" style="text-decoration:none;" target="_blank" title=""><img alt="LIVE NATION" data-assetid="1047707" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/2396e239-7cad-41c8-afa8-69321cb53052.png" style="display: block; max-width: 320px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; border: none; text-align: center;" width="320"></a></td></tr></table></td></tr></table></td></tr><tr> <td align="center" valign="top"> <table bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_full_wrap" width="100%"> <tr> <td class="em_h20" height="35" style="height:35px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table></td></tr></table></td> </tr> </table> <!-- == C1-Header Global Section == --> <!-- == C2-Header Section == --> <table width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td valign="top" align="center"></td> </tr> </table> <!-- == //C2-Header Section == --> <!-- == C3-Header Section == --> <table bgcolor="#ffffff" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"></td> </tr> </table> <!-- ==//C3-Header Section == --> <!-- == C4 HEADER Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"> <table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_hide" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e6d964fcd28162de392e00db76317f1d3968643c983f8bde294b1d87930e3b1907a8e9845ccb54e7884e119157ca71392" style="text-decoration:none;" target="_blank" title=""><img alt="Ari" data-assetid="1053717" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/6fcf69c6-1490-43bd-b9b3-553e412de40b.png" style="display: block; max-width: 600px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; text-align: center; height: auto; width: 100%; border: none;" width="600"></a></td></tr><tr> <td align="center" bgcolor="#ffffff" class="em_aside10" style="padding:0px 20px 0px;" valign="top"> <div style="text-align: right;"> <span style="font-size:8px;"><span style="font-family:Arial,Helvetica,sans-serif;">Photo: Ariana Grande | GettyImages</span></span></div><table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td class="em_h20" height="45" style="height:45px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a157057027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_pbottom" style="padding-bottom:23px;" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0"> <tr> <td align="center" class="em_side20" valign="middle"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_side20" style="width:56px;" width="56"> <tr> <td width="56"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/9adcffa4-c990-4d0b-a9cc-dff7fbbfc675.gif" style="display:block; border:none;width:56px"></td></tr></table></td><td class="em_side10" style="width:8px;" width="8"> </td><td align="center" class="em_defaultlink em_font_15_3" style="font-size:27px; line-height:30px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold;" valign="middle"> <span style="font-size:18px;">TRENDING</span></td><td class="em_side10" style="width:8px;" width="8"> </td><td align="center" class="em_side20" valign="middle"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_side20" style="width:56px;" width="56"> <tr> <td width="56"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/9adcffa4-c990-4d0b-a9cc-dff7fbbfc675.gif" style="display:block; border:none;width:56px"></td></tr></table></td></tr></table></td></tr><tr> <td align="center" class="em_defaultlink em_font_15 em_pbottom" style="line-height: 50px; color: rgb(0, 0, 0); font-family: proxima-nova, Arial, sans-serif; font-weight: 600; padding-bottom: 27px;" valign="top"> <span style="font-size:22px;">LIVE FROM HOME</span></td></tr><tr> <td align="center" class="em_defaultlink em_font_15_2" style="line-height: 22px; color: rgb(0, 0, 0); font-family: proxima-nova, Arial, sans-serif; padding-bottom: 20px; padding-left: 20px; padding-right: 20px;" valign="middle"> <span style="font-size: 15px;">We can't stop listening to <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e13066c726fc5c21eae4c401bd33e2ea50d4359de1c4398184ca440cb49753eaac88d92d0114f998f15922b60980137d0" style="text-decoration:underline;" title="Rain On Me">Rain On Me</a> by <b>Lady Gaga </b>and <b>Ariana Grande </b>off Gaga's new album, <b>CHROMATICA </b>- which was released today!<br> <br> Join Kiwi superstar <b>BENEE </b>as she takes you on an ASMR adventure while chatting about her track, Blu.<br> <br> Finally, tune into a mix of content from <b>LIVE FROM HOME: AROUND THE WORLD</b>, including an insane DJ set from the top of the alps in France, and the best bits from BBC Radio 1's Big Weekend, featuring <b>RITA ORA, BIFFY CLYRO </b>and the <b>JONAS BROTHERS.</b></span></td></tr><tr> <td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_btnwidth"> <tr> <td align="center" bgcolor="#e21836" class="em_defaultlink em_h33btn3 em_btnpad2" height="60" style="height:60px; font-size:20px; font-weight:600; border-radius:35px; display:block; padding:0px 80px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn3" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=02ba0d7cdfba728e6d964fcd28162de392e00db76317f1d3968643c983f8bde294b1d87930e3b1907a8e9845ccb54e7884e119157ca71392" style="color:#ffffff;text-decoration:none; display:block; line-height:60px;" target="_blank" title="">SEE MORE</a></td></tr></table></td></tr><tr> <td class="em_h30" height="55" style="height:55px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td class="em_h20" height="35" style="height:35px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_hide" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table></td> </tr> </table> <!-- == //C4 HEADER Section == --> <!-- == C4-Hero full width Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><!-- == C8-CARD 2COL Section == --><table bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_full_wrap" width="100%"> <tr> <td align="center" valign="top"> <table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" bgcolor="#ffffff" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="left" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761ac25af4a7cc7561a6d5e47bf834c11ee1d0923e40a7ce757e9439543e3e2fe298693a5df83729e485ace068deba804bc4" style="text-decoration:none;" target="_blank" title=""><img alt="ROM" data-assetid="1053896" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/02ba741b-7ef2-4846-8c52-365fb1f7e93c.png" style="display: block; max-width: 292px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="292"></a></td></tr><tr> <td style="text-align: right;" valign="top"> </td></tr><tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" class="em_defaultlink em_font11 em_pbottom10" style="font-size:20px; line-height:25px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold; padding-bottom:23px;" valign="top"> <span style="color:#e21836;">—</span> NEW VIDEO <span style="color:#e21836;">—</span></td></tr><tr> <td align="center" class="em_defaultlink em_font_15_4" style="font-size:24px; line-height:28px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:900;" valign="top"> RAIN ON ME</td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td><td class="em_side10" style="width:16px; background-color:#f0f0f0;"> </td><td align="right" valign="top"> <table align="right" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a18f3d8bd4916bae32640625c933e37d78b5ef6d30256a875e71807b4291c421e3a762be2db3c0dfa24298d0a0ee84f42" style="text-decoration:none;" target="_blank" title=""><img alt="Willie Gomez" data-assetid="1053695" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/b5385519-89c7-40b4-a2a6-67fc39d04dd5.png" style="display: block; max-width: 292px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="292"></a></td></tr><tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" class="em_defaultlink em_font11 em_pbottom10" style="font-size:20px; line-height:25px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold; padding-bottom:23px;" valign="top"> <span style="color:#e21836;">—</span> CHEF NATION <span style="color:#e21836;">—</span></td></tr><tr> <td align="center" class="em_defaultlink em_font_15_4" style="font-size:24px; line-height:28px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:900;" valign="top"> WILLIE GOMEZ</td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table><p> </p></td></tr><tr> <td align="left" valign="top" width="48%"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper"> <tr> <td align="center" bgcolor="#e21836" class="em_defaultlink em_h33btn2 em_aside15" height="60" style="height:60px; font-size:20px; font-weight:900; border-radius:35px; display:block; padding:0px 45px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn2" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761ac25af4a7cc7561a6d5e47bf834c11ee1d0923e40a7ce757e9439543e3e2fe298693a5df83729e485ace068deba804bc4" style="color:#ffffff;text-decoration:none; display:block; line-height:60px;" target="_blank" title="">WATCH HERE</a></td></tr></table></td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td><td class="em_side10" style="width:16px; background-color:#f0f0f0;" width="16"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" valign="top" width="48%"> <table align="right" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper"> <tr> <td align="center" bgcolor="#e21836" class="em_defaultlink em_h33btn2 em_aside15 em_font_15_2" height="60" style="height:60px; font-size:20px; font-weight:900; border-radius:35px; display:block; padding:0px 45px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn2" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a18f3d8bd4916bae32640625c933e37d78b5ef6d30256a875e71807b4291c421e3a762be2db3c0dfa24298d0a0ee84f42" style="color:#ffffff;text-decoration:none; display:block; line-height:60px;" target="_blank" title="">WATCH HERE</a></td></tr></table></td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td></tr></table></td></tr><tr> <td class="em_h20" height="20" style="height:20px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><!-- ==//C8-CARD 2COL Section == --></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><!-- == C8-CARD 2COL Section == --><table bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_full_wrap" width="100%"> <tr> <td align="center" valign="top"> <table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" bgcolor="#ffffff" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="left" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761adc93167ce25a2addd95edc43d86f7ea904b832ae6a731de5f621c07c13068f2685073c96b227027fde055bb2139f61e4" style="text-decoration:none;" target="_blank" title=""><img alt="Twenty One Pilots" data-assetid="1053725" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/d54b2607-e6db-485e-a1f9-4ce6cfdea8e7.png" style="display: block; max-width: 292px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="292"></a><div style="text-align: right;"> <span style="font-size:8px;"><span style="font-family:Arial,Helvetica,sans-serif;">Photo: Twenty One Pilots | Steven Cook</span></span></div></td></tr><tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" class="em_defaultlink em_font11 em_pbottom10" style="font-size:20px; line-height:25px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold; padding-bottom:23px;" valign="top"> <span style="color:#e21836;">—</span> LIVE <span style="color:#e21836;">—</span></td></tr><tr> <td align="center" class="em_defaultlink em_font_15_4" style="font-size:24px; line-height:28px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:900;" valign="top"> TWENTY ONE<br> PILOTS</td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td><td class="em_side10" style="width:16px; background-color:#f0f0f0;"> </td><td align="right" valign="top"> <table align="right" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a3b87753fa5d42113639e3214faac83a5f6a7dded537d2f300bdab99789014d50abe4b0c45bbf4ec5aa50f2da790784cf" style="text-decoration:none;" target="_blank" title=""><img alt="Benee" data-assetid="1053716" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/c80be259-7b3a-4b46-b40f-1099d1fac7b9.png" style="display: block; max-width: 292px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="292"></a><div style="text-align: right;"> <span style="font-size:8px;"><span style="font-family:Arial,Helvetica,sans-serif;">Photo: Benee | Jess Gleeson</span></span></div></td></tr><tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" class="em_defaultlink em_font11 em_pbottom10" style="font-size:20px; line-height:25px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold; padding-bottom:23px;" valign="top"> <span style="color:#e21836;">—</span> BENEEFIED <span style="color:#e21836;">—</span></td></tr><tr> <td align="center" class="em_defaultlink em_font_15_4" style="font-size:24px; line-height:28px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:900;" valign="top"> ASMR WITH<br> BENEE</td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table><p> </p></td></tr><tr> <td align="left" valign="top" width="48%"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper"> <tr> <td align="center" bgcolor="#e21836" class="em_defaultlink em_h33btn2 em_aside15" height="60" style="height:60px; font-size:20px; font-weight:900; border-radius:35px; display:block; padding:0px 45px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn2" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761adc93167ce25a2addd95edc43d86f7ea904b832ae6a731de5f621c07c13068f2685073c96b227027fde055bb2139f61e4" style="color:#ffffff;text-decoration:none; display:block; line-height:60px;" target="_blank" title="">LISTEN HERE</a></td></tr></table></td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td><td class="em_side10" style="width:16px; background-color:#f0f0f0;" width="16"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" valign="top" width="48%"> <table align="right" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td bgcolor="#ffffff" class="em_p5" style="padding:25px 20px 10px;"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper"> <tr> <td align="center" bgcolor="#e21836" class="em_defaultlink em_h33btn2 em_aside15 em_font_15_2" height="60" style="height:60px; font-size:20px; font-weight:900; border-radius:35px; display:block; padding:0px 45px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn2" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a3b87753fa5d42113639e3214faac83a5f6a7dded537d2f300bdab99789014d50abe4b0c45bbf4ec5aa50f2da790784cf" style="color:#ffffff;text-decoration:none; display:block; line-height:60px;" target="_blank" title="">WATCH HERE</a></td></tr></table></td></tr></table></td></tr><tr> <td align="center" valign="top"> <a href="#" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_full_img1-spacer" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none; max-width:292px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="292"></a></td></tr></table></td></tr></table></td></tr><tr> <td class="em_h20" height="20" style="height:20px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><!-- ==//C8-CARD 2COL Section == --></td></tr></table></td> </tr> </table> <!-- == //C4-Hero full width Section == --> <!-- == C7-SECONDARY CONTENT Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><!-- Insert ‌ hack after hidden preview text --><div style="display: none; max-height: 0px; overflow: hidden;"> ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ ‌ </div><table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td align="center" class="em_defaultlink em_font_301" style="font-size:40px; line-height:25px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:600; padding: 0px 0px 0px 0px;" valign="top"> <span style="font-size:24px;">AROUND THE WORLD</span></td></tr></table><table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_h20" height="35" style="height:35px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" bgcolor="#F0F0F0" class="em_w40" style="width:80px;" valign="top" width="80"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a984312794bfaeb7f0cb2dbcc2f2a929cb33298d8f1a3f70a2e46c230d339a4815cc5ac745e258a3d073cdf5c931398c7" style="text-decoration:none;" target="_blank" title=""><img alt="The Blaze" data-assetid="1053700" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/57225bc6-159e-4ef1-a2ec-3bef78437681.png" style="display: block; max-width: 80px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="80"></a></td><td class="em_side10" style="width:15px;" width="15"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="left" valign="top"> <table align="left" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:418px;" width="418"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="left" class="em_defaultlink em_font111" style="font-size: 18px; line-height: 23px; font-family: proxima-nova, Arial, sans-serif; font-weight: bold; padding-bottom: 5px;" valign="top"> FRANCE<br> <font color="#e21836">THE BLAZE | LIVE FROM THE ALPS</font></td></tr><tr> <td class="em_h151" height="10" style="height:10px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" class="em_w20" style="width:47px;" valign="top" width="47"> <table align="right" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:47px;" width="47"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_w20" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a984312794bfaeb7f0cb2dbcc2f2a929cb33298d8f1a3f70a2e46c230d339a4815cc5ac745e258a3d073cdf5c931398c7" style="text-decoration:none;" target="_blank" title=""><img src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/a026d954-ab8f-4959-9af6-66522524426c.jpg" style="display: block; max-width: 47px; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="47"></a></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" bgcolor="#F0F0F0" class="em_w40" style="width:80px;" valign="top" width="80"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a0060c07110645b66b870090d5b83606002a43cc40f772604072e1defcc62818b19e658f9267e16a6d794acf4fbc075da" style="text-decoration:none;" target="_blank" title=""><img alt="The Black Crowes" data-assetid="1054167" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/88a0e1f7-13fe-4229-af3e-2dffbc3cbf8e.png" style="display: block; max-width: 80px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="80"></a></td><td class="em_side10" style="width:15px;" width="15"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="left" valign="top"> <table align="left" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:418px;" width="418"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="left" class="em_defaultlink em_font111" style="font-size: 18px; line-height: 23px; font-family: proxima-nova, Arial, sans-serif; font-weight: bold; padding-bottom: 5px;" valign="top"> CANADA<br> <font color="#e21836">BUDWEISER STAGE AT HOME</font></td></tr><tr> <td class="em_h151" height="10" style="height:10px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" class="em_w20" style="width:47px;" valign="top" width="47"> <table align="right" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:47px;" width="47"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_w20" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a0060c07110645b66b870090d5b83606002a43cc40f772604072e1defcc62818b19e658f9267e16a6d794acf4fbc075da" style="text-decoration:none;" target="_blank" title=""><img src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/a026d954-ab8f-4959-9af6-66522524426c.jpg" style="display: block; max-width: 47px; padding: 0px; text-align: center; height: auto; width: 100%; border: none;" width="47"></a></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" bgcolor="#F0F0F0" class="em_w40" style="width:80px;" valign="top" width="80"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a8d8a17ebb0f5295e97d8b62690619a1608f182c595d81f32a46fd6f6647beb520e48eef810f0acb5e22637a0257f02a6" style="text-decoration:none;" target="_blank" title=""><img alt="Rita Ora" data-assetid="1053911" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/611af037-b1d9-4ce4-b511-8b6f486c299e.png" style="display: block; max-width: 80px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="80"></a></td><td class="em_side10" style="width:15px;" width="15"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="left" valign="top"> <table align="left" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:418px;" width="418"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="left" class="em_defaultlink em_font111" style="font-size: 18px; line-height: 23px; font-family: proxima-nova, Arial, sans-serif; font-weight: bold; padding-bottom: 5px;" valign="top"> UK<br> <font color="#e21836">BBC RADIO 1 | BIG WEEKEND</font></td></tr><tr> <td class="em_h151" height="10" style="height:10px; line-height:0px; font-size:0px;"> hon</td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" class="em_w20" style="width:47px;" valign="top" width="47"> <table align="right" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:47px;" width="47"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_w20" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a8d8a17ebb0f5295e97d8b62690619a1608f182c595d81f32a46fd6f6647beb520e48eef810f0acb5e22637a0257f02a6" style="text-decoration:none;" target="_blank" title=""><img src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/a026d954-ab8f-4959-9af6-66522524426c.jpg" style="display: block; max-width: 47px; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="47"></a></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" bgcolor="#F0F0F0" class="em_w40" style="width:80px;" valign="top" width="80"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761ad00f45665019629af88dd407c7c47fa6f6b48ecffa618e7bebe75339b9a451a44a8d7ebf6d6b456770af9b9566570de2" style="text-decoration:none;" target="_blank" title=""><img alt="Idris Elba" data-assetid="1053698" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/7cc37c90-c0c6-4432-b976-19bb2225bfe9.png" style="display: block; max-width: 80px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="80"></a></td><td class="em_side10" style="width:15px;" width="15"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="left" valign="top"> <table align="left" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:418px;" width="418"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="left" class="em_defaultlink em_font111" style="font-size: 18px; line-height: 23px; font-family: proxima-nova, Arial, sans-serif; font-weight: bold; padding-bottom: 5px;" valign="top"> SOUTH AFRICA<br> <font color="#e21836">AFRICA DAY BENEFIT CONCERT</font></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" class="em_w20" style="width:47px;" valign="top" width="47"> <table align="right" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:47px;" width="47"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_w20" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761ad00f45665019629af88dd407c7c47fa6f6b48ecffa618e7bebe75339b9a451a44a8d7ebf6d6b456770af9b9566570de2" style="text-decoration:none;" target="_blank" title=""><img src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/a026d954-ab8f-4959-9af6-66522524426c.jpg" style="display: block; max-width: 47px; padding: 0px; text-align: center; height: auto; width: 100%; border: none;" width="47"></a></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" valign="top"> <table align="left" bgcolor="#ffffff" border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="left" bgcolor="#F0F0F0" class="em_w40" style="width:80px;" valign="top" width="80"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761af931ac9bed54aaa56ef9d4a13960c28e31e44924dea80a60734510b8c559ad5c5697c24c0de8c715d8fdae89a3337eca" style="text-decoration:none;" target="_blank" title=""><img alt="Felix Sandman" data-assetid="1053699" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/b4b6c56b-905f-4a44-9cf6-29a734387398.png" style="display: block; max-width: 80px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; height: auto; width: 100%; text-align: center; border: none;" width="80"></a></td><td class="em_side10" style="width:15px;" width="15"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="left" valign="top"> <table align="left" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:418px;" width="418"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1">rad</td></tr><tr> <td align="left" class="em_defaultlink em_font111" style="font-size: 18px; line-height: 23px; font-family: proxima-nova, Arial, sans-serif; font-weight: bold; padding-bottom: 5px;" valign="top"> SWEDEN<br> <font color="#e21836">FELIX SANDMAN | LIVE STREAM</font></td></tr><tr> <td class="em_h151" height="10" style="height:10px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="right" class="em_w20" style="width:47px;" valign="top" width="47"> <table align="right" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" style="width:47px;" width="47"> <tr> <td class="em_h151" height="18" style="height:18px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" class="em_w20" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761af931ac9bed54aaa56ef9d4a13960c28e31e44924dea80a60734510b8c559ad5c5697c24c0de8c715d8fdae89a3337eca" style="text-decoration:none;" target="_blank" title=""><img src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/a026d954-ab8f-4959-9af6-66522524426c.jpg" style="display: block; max-width: 47px; padding: 0px; text-align: center; height: auto; width: 100%; border: none;" width="47"></a></td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td height="15" style="height:15px; line-height:0px; font-size:0px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td align="center" valign="top"> </td></tr></table></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_full_wrap" width="100%"> <tr> <td align="center" valign="top"> <table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_wrapper" width="100%"> <tr> <td align="center" valign="top"> <a data-linkto="https://" href="http://click.info.livenation.com.au/?qs=5a0049e322a2761a8be93fb0c94ff40739de94fecc9f32b2860b0589d2f15708d52c1ba453e1e0b48c405f636e611da383287b938afb6403" style="text-decoration:none;" target="_blank" title=""><img alt="The Sound of Silence" data-assetid="1054187" src="http://image.info.livenation.com.au/lib/fe9c15747365007f74/m/3/d3e0e298-dc7b-4f27-836a-e102e1738f24.png" style="display: block; max-width: 636px; font-size: 17px; line-height: 20px; font-family: Arial, sans-serif; color: #FFFFFF; font-weight: bold; padding: 0px; text-align: center; height: auto; width: 100%; border: none;" width="600"></a></td><td class="em_side10" style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><!-- ==//C8-CARD 2COL Section == --></td></tr><tr> <td class="em_h20" height="35" style="height:35px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table align="center" bgcolor="#f0f0f0" border="0" cellpadding="0" cellspacing="0" class="em_main_table" style="width:640px; table-layout:fixed;" width="640"> <tr> <td style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td><td align="center" class="em_h20" style="padding:0px 25px 0px;" valign="top"> <table border="0" cellpadding="0" cellspacing="0" width="100%"> <tr> <td align="center" class="em_defaultlink em_font_17 em_pbottom" style="font-size:35px; line-height:38px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; font-weight:600; padding-bottom:30px;" valign="top"> MY LIVE NATION PRESALES</td></tr><tr> <td align="center" class="em_defaultlink em_font_15_2" style="font-size:18px; line-height:23px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; padding-bottom:31px;" valign="top"> Register with Live Nation to be amongst the first to buy Presale tickets to the hottest shows in town before the general public. Plus receive the latest events and special offers straight to your inbox.</td></tr><tr> <td align="center" valign="top"> <table align="center" border="0" cellpadding="0" cellspacing="0" class="em_btnwidth"> <tr> <td align="center" class="em_defaultlink em_h33btn3 em_btnpad" height="54" style="height:54px; font-size:20px; font-weight:600; border:3px #e21836 solid; border-radius:35px; display:block; padding:0px 90px; color:#000000; font-family: 'proxima-nova', Arial, sans-serif; " valign="middle"> <a class="em_h33btn3" data-linkto="https://" href="http://click.info.livenation.com.au/?qs=78db696f6deb1a73427728e0be4d23e8b10cd9a7120ddc65f39ff46be3342444515ee9bbad3514e139cd3cc5f2dc7d264059453732797f24" style="color:#000000;text-decoration:none; display:block; line-height:54px;" target="_blank" title="">REGISTER</a></td></tr></table></td></tr></table></td><td style="width:20px;" width="20"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr><tr> <td class="em_h20" height="35" style="height:35px;"> <img alt="" height="1" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1"></td></tr></table></td></tr></table></td> </tr> </table> <!-- == //C7-SECONDARY CONTENT Section == --> <!-- == C6-Hero Standard full width Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table class="em_full_wrap" width="100%" cellspacing="0" cellpadding="0" border="0" bgcolor="#e22235"> <tr> <td class="em_hauto" style="background:url(http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/d656065b-3200-466d-98ce-547c2fa06b2a.jpg) center no-repeat;" valign="top" background="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/d656065b-3200-466d-98ce-547c2fa06b2a.jpg" align="center"> <!--[if gte mso 9]> <v:rect xmlns:v="urn:schemas-microsoft-com:vml" fill="true" stroke="false" style="mso-width-percent:1000;height:400px;"> <v:fill type="frame" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/d656065b-3200-466d-98ce-547c2fa06b2a.jpg" color="#e22235" /> <v:textbox inset="0,0,0,0"> <![endif]--><table class="em_main_table" style="width:640px; table-layout:fixed;" width="640" cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td valign="top"> <table class="em_wrapper" style="width:640px;" width="640" cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td class="em_hide" style="width:20px;" width="20"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td><td valign="top" align="center"> <table width="100%" cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td class="em_h30" style="height:60px; line-height:0px; font-size:0px;" height="60"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr><tr> <td class="em_pbottom" valign="top" align="center"> <table cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td class="em_side20" valign="middle" align="center"> <table class="em_side20" style="width:36px;" width="36" cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td class="em_h1" style="width:36px; height:3px; line-height:0px; font-size:0px;" width="36" height="3" bgcolor="#ffffff"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr></table></td><td class="em_side10" style="width:16px;" width="16"> </td><td class="em_defaultlink em_font_15_2" style="font-size:27px; line-height:30px; color:#ffffff; font-family: 'proxima-nova', Arial, sans-serif; font-weight:bold;" valign="top" align="center"> FOLLOW US</td><td class="em_side10" style="width:16px;" width="16"> </td><td class="em_side20" valign="middle" align="center"> <table class="em_side20" style="width:36px;" width="36" cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td class="em_h1" style="width:36px; height:3px; line-height:0px; font-size:0px;" width="36" height="3" bgcolor="#ffffff"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr></table></td></tr></table></td></tr><tr> <td class="em_hide" style="height:30px; line-height:0px; font-size:0px;" height="30"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr><tr> <td valign="top" align="center"> <table cellspacing="0" cellpadding="0" border="0" align="center"> <tr> <td valign="top" align="center"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a737bc79df743d703531d609e1c535b79cfceb4a11e0b4d664940a2f9c59ad4d3a03f98b0cbf02f3963bc742f2fa4b0c225" style="text-decoration:none;" target="_blank"><img alt="fb" class="em_g_img em_w35" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/6f310fbf-89a3-44b3-aec3-de534ffe38e4.png" style="display:block; border:none; max-width:71px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="71"></a></td><td class="em_side10" style="width:30px;" width="30"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td><td valign="top" align="center"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a73dc26c4cafdb2cbe4ffbf2ee9c62949ce2907b9a6ee50a00e7239f77a11ffcdd3dbd82f443d32140ff88f644b74d43e92" style="text-decoration:none;" target="_blank"><img alt="tw" class="em_g_img em_w35" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/6c194ad7-fde9-4e9b-82e5-3e5557dabe3f.png" style="display:block; border:none; max-width:71px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="71"></a></td><td class="em_side10" style="width:30px;" width="30"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td><td valign="top" align="center"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a731008cadd0a0a6949c9c58aaa949bfbe4f88fea58c7b6b8cc7a9bea4652c5d238e1dbaf3828bc21307c072debd23807fb" style="text-decoration:none;" target="_blank"><img alt="yt" class="em_g_img em_w35" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/b4f18890-ddda-4f88-a50d-79fe2d11bab9.png" style="display:block; border:none; max-width:71px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="71"></a></td><td class="em_side10" style="width:30px;" width="30"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td><td valign="top" align="center"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a7359c2ea77f2f6bcc6d2377d1833dea25b0b4010fc94aa2af36b5adc97f070093ac6db080d90ba7226390a4f765efbfb65" style="text-decoration:none;" target="_blank"><img alt="insta" class="em_g_img em_w35" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/6b9c8665-3296-4889-9edf-a8fe90eebc62.png" style="display:block; border:none; max-width:71px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="71"></a></td><td class="em_side10" style="width:30px;" width="30"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td><td valign="top" align="center"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a7311adb40e10fd6d0f79184df2833664d3aec8a38e4f838183d1c6838726cfe71fe486a1b6361c8e5d8b6a1d73c7307988" style="text-decoration:none;" target="_blank"><img alt="" class="em_g_img em_w35" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/b63acb12-8cf3-4ed9-9934-e1e82186d35a.png" style="display:block; border:none; max-width:71px; font-size:17px; line-height:20px; font-family:Arial, sans-serif; color:#ffffff; font-weight:bold;" width="71"></a></td></tr></table></td></tr><tr> <td class="em_h103" style="height:200px;" height="200"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr></table></td><td class="em_hide" style="width:20px;" width="20"> <img alt="" src="http://image.info.livenation.co.uk/lib/fe9a15707367027e77/m/2/558964e6-6903-49fe-986c-eac46993aed0.gif" style="display:block; border:none;" width="1" height="1"></td></tr></table></td></tr></table><!--[if gte mso 9]> </v:textbox> </v:rect> <![endif]--></td></tr></table></td></tr></table></td> </tr> </table> <!-- == //C6-Hero Standard full width Section == --> <!-- == C8-CARD 2COL Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"></td> </tr> </table> <!-- ==//C8-CARD 2COL Section == --> <!-- == C10 SINGLE ARTIST Section == --> <table bgcolor="#f0f0f0" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"></td> </tr> </table> <!-- == //C10 SINGLE ARTIST Section == --> <!-- == C11 SOCIAL LINKS Section == --> <table bgcolor="#e22235" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"></td> </tr> </table> <!-- == //C11 SOCIAL LINKS Section == --> <!-- == C10 FOOTER Section == --> <table bgcolor="#000000" width="100%" border="0" cellspacing="0" cellpadding="0" class="em_full_wrap"> <tr> <td align="center" valign="top"><table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"> <table cellpadding="0" cellspacing="0" width="100%" style="min-width: 100%; " class="stylingblock-content-wrapper"><tr><td class="stylingblock-content-wrapper camarker-inner"><table cellspacing="0" cellpadding="0" border="0"> <tr> <td valign="top" align="center"> <table style="border-collapse: collapse; padding: 0px; color: #4c4c4c; font-size: 16px;" class="mobileWidth" id="recovery" width="100%" cellspacing="0" cellpadding="0" border="0" bgcolor="#000000"> <tr> <td style="padding: 21px;" valign="top"> <table style="padding: 0px; color: #4c4c4c; font-size: 16px;" width="100%" cellspacing="0" cellpadding="0" border="0"> <tr> <td style="padding: 0px; margin: 0px; line-height: 2.1em; font-size: 16px; text-align: center;" class="recovery-links" valign="top" bgcolor="#000000"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a730a42dc9c852d16432a2c9ca05ba75713cf4008da29a8e09771f805010c13d329fd7f2d8c0fbbf5dc07faf4046a577742" title="Click here for concerts & events" style="font-family: Helvetica,Arial,sans-serif; color: #ffffff; font-size: 16px; text-decoration: none; font-weight: bold;">Concerts & Events</a> | <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a735f665f5680afb9731996b8326e3ce6f5e3211469476e499334ee065e4d4523e72a0628670dbdb503770b8e7cbd4cb1cd" title="Click here for festivals" style="font-family: Helvetica,Arial,sans-serif; color: #ffffff; font-size: 16px; text-decoration: none; font-weight: bold;">Festivals</a> | <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a7304ee2a838ea786859899eb5d0d1b1c0e2ad6efa4c0133f4bdff31fc74e49ce05db4a8375b0888f17c937aa390aed0217" title="Click here for VIP tickets" style="font-family: Helvetica,Arial,sans-serif; color: #ffffff; font-size: 16px; text-decoration: none; font-weight: bold;">VIP Tickets</a> </td> </tr> </table> </td> </tr> <tr> <td style="padding: 10px 21px 21px;" valign="top"> <table style="border-collapse: collapse; padding: 0px; color: #a1a1a2; font-size: 11px; text-align: center;" id="legal" class="inner" width="100%" cellspacing="0" cellpadding="0" border="0" bgcolor="#000000"> <tr> <td style="padding: 0px; margin: 0px; line-height: normal;" class="footer-links" valign="top" bgcolor="#000000"> <a href="http://click.info.livenation.com.au/?qs=78db696f6deb1a73c00dc8737578de38882ade9c81ae25ad8a15541d892753beeb4a2cae53fad0c747d3407595794464bfa795ee02d759b0" title="Click here for our privacy policy" style="font-family: Helvetica,Arial,sans-serif; color: #e0e0e0; font-size: 11px; text-decoration: underline;">Privacy Policy</a> <a href="http://click.info.livenation.com.au/?qs=ab8ab4ba066a4149b71e826a79035a96810f12c0785509bc746a11f1f954131818331fe2728758e1aca986f5cc7780183278f4dc82251a9c" title="Click here for our terms & conditions" style="font-family: Helvetica,Arial,sans-serif; color: #e0e0e0; font-size: 11px; text-decoration: underline;">Terms & Conditions</a> <a href="http://click.info.livenation.com.au/?qs=ab8ab4ba066a4149b3eef516063720f6089cbd1fe9cdee597d590f9a4be94aaff1e885bea68278a0e8e75598aaaceffb01edf97a05dc81b5" title="Click here to contact us" style="font-family: Helvetica,Arial,sans-serif; color: #e0e0e0; font-size: 11px; text-decoration: underline;">Contact Us</a> <a href="http://click.info.livenation.com.au/?qs=ab8ab4ba066a41493e1a8696c2b43bfc3383cb2a0936b58d582819644d6cebef49b50cb444373625516610ad51ee888962903a453f5ca3f6" title="Click here to unsubscribe" style="font-family: Helvetica,Arial,sans-serif; color: #e0e0e0; font-size: 11px; text-decoration: underline;" >Unsubscribe</a> </td> </tr> <tr> <td style="padding: 0px; margin: 0px; line-height: 0px;" valign="top" bgcolor="#000000" height="18"></td> </tr> <tr> <td style="font-family: Helvetica,Arial,sans-serif; padding: 0px; margin: 0px; line-height: 1.2em; color: #e0e0e0; font-size: 11px;" valign="top" bgcolor="#000000"> © 2020 Live Nation Australasia Pty Ltd. Live Nation ® is a registered trademark of Live Nation Entertainment. </td> </tr> <tr> <td style="padding: 0px; margin: 0px; line-height: 0px;" valign="top" bgcolor="#000000" height="15"></td> </tr> <tr> <td style="font-family: Helvetica,Arial,sans-serif; padding: 0px; margin: 0px; line-height: 1.2em; color: #e0e0e0; font-size: 11px;" valign="top" bgcolor="#000000"> If you wish us to update our records to exclude you from receiving future emails regarding presales, special offers and advance notice of forthcoming Live Nation events, log on and update your preferences. Please do not reply to this email. </td> </tr> <tr> <td style="padding: 0px; margin: 0px; line-height: 0px;" valign="top" bgcolor="#000000" height="15"></td> </tr> <tr> <td style="font-family: Helvetica,Arial,sans-serif; padding: 0px; margin: 0px; line-height: 1.2em; color: #e0e0e0; font-size: 11px;" valign="top" bgcolor="#000000"> Our emails contain technologies to track how you interact with them. We do this to help improve our emails and for online behavioural advertising purposes. For further information, including how to disable such technologies, please see our privacy and cookies policies. </td> </tr> </table> </td> </tr> </table> </td> </tr> </table></td></tr></table> </td></tr></table></td> </tr> </table> <!-- == //C10 FOOTER Section == --> <img src="http://click.info.livenation.com.au/open.aspx?ffcb10-fe921770706d0c7e74-fdf31c727163027d7513727d-fe9c15747365007f74-ff5f11727c-fdef1571706c0c7571177671-ff66177073" width="1" height="1"> </body> </html> --5I0TDzOslYIZ=_?:--
| ver. 1.4 |
Github
|
.
| PHP 7.4.33 | Generation time: 0 |
proxy
|
phpinfo
|
Settings